KEGG   Vitis vinifera (wine grape): 100254083Help
Entry
100254083         CDS       T01084                                 

Definition
mitogen-activated protein kinase homolog NTF3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100254083
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100254083
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100254083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 371 aa AA seqDB search
MATPVEPPNGTRCEGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNKETNEKVAI
KKIHNAFDNRVDALRTLREIKLLRHLRHENVIALKDVMMPIHRRSFKDVYLVYELMDTDL
HQIIKSSQALTNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTSTGKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIINILGSQREADIEFIDNPKARKYIKSLPFSPGTPFSRLYPNAHPMAIDLLQKML
IFDPSKRIGVTEALQHPFMSSLYDPSKNPPAQVPIDLDIDEDLGEEMIREMMWKEMLHYH
PEAVTSNGEAS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcaactccagttgagcctccaaatgggactagatgcgaaggaaaacattattattca
atgtggcagactttgtttgagattgatacaaaatatgtgcccatcaagccaataggtcgg
ggagcatacggtatcgtgtgctcttctgtgaacaaggaaaccaatgagaaagttgcaatt
aagaagatacataatgcgtttgataaccgtgttgatgcactgagaactttgcgtgagatt
aaacttcttcggcatcttcgacatgaaaatgtgattgctttaaaagatgtcatgatgcct
atacacaggagaagtttcaaggatgtctatctggtttatgaactcatggatacggatttg
caccagattattaagtcctcccaagcgcttactaatgaccactgccaatattttctgttc
cagttgctccgaggcctgaagtatctccactcagcaaacatcctccaccgagacttgaag
cctggaaaccttcttatcaatgcaaactgtgacctaaaaatatgtgattttgggctagct
cgaactagcactggcaagggccagttcatgactgagtatgtggtcactcgctggtacagg
gccccagaactcctcctctgctgtgacaactatggaacctccattgatgtgtggtctgtt
ggatgcatctttgcggagcttctcggccggaaacctatattccctggcacagagtgtctt
aaccagctcaaactgatcatcaacatccttgggagccagagggaggctgatattgaattc
attgacaaccccaaagcaaggaaatacatcaagtctctcccgttctcaccagggacgcct
ttttcccgtctttacccaaatgcccatcccatggcaattgatctgctgcagaagatgcta
atttttgacccctcaaagaggattggtgtcaccgaagcactccaacaccctttcatgtcc
tcactgtatgatcccagtaagaaccctccagcacaggtccccattgatctggacatagac
gaggatttaggggaagagatgataagggagatgatgtggaaggaaatgctccattatcat
cctgaagctgttacaagcaatggggaggcaagttag

DBGET integrated database retrieval system