KEGG   Vitis vinifera (wine grape): 100254223Help
Entry
100254223         CDS       T01084                                 

Definition
SNF1-related protein kinase catalytic subunit alpha KIN10-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100254223
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100254223
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100254223
Mitochondrial biogenesis [BR:vvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100254223
  Mitophagy factors
   Other mitophagy factors
    100254223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 508 aa AA seqDB search
MDGPTGRGGGGVDMFLSNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEM
EEKVRREIKILRLFMHPHIIRLYEVIETPSDIFVVMEYVKSGELFDYIVEKGRLQEEEAR
NFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSP
NYAAPEVISGRLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHL
STGARDLIPRMLIVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDTIQQAKKIDEEILQE
VVKMGFDRNLLVESLRNRVQNDATVAYYLLLDNRFRVSSGYLGAEFQESLEYQFNRSEAG
AVGQRFPGYVDYQGMGLRTQFPAERKWALGLQSRAQPRQIMTEVLKALQELNVCWKKIGH
YNMKCRWIPGIPGHHEGMVNNPVHSNHFFGDEPAIVENDGVSRNVVKFEVQLYKTREEKY
LLDLQRVQGPQFLFLDLCAAFLAQLRVL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggatggaccaactgggcggggtggtggtggtgtggatatgttcttatcaaactataag
ctggggaaaacccttggcattggttcatttggtaaggttaaaattgcagaacatgcatta
actggacacaaagttgctatcaagatccttaaccgtcggaagataaagaacatggaaatg
gaagaaaaagtgagaagagaaatcaaaatattgagattgttcatgcaccctcacatcatt
cgactttatgaggttatagagacacccagtgatatttttgtcgtgatggagtatgtgaag
tctggagagctttttgattacattgtagagaagggcaggctacaggaggaagaagctcgt
aacttttttcaacagataatttctggcgtggagtactgccacaggaatatggtagttcac
agagatcttaaacctgagaacttgcttttggattccaaatgcaatgtgaagattgctgat
tttggtttaagtaatatcatgagagatggtcattttttgaagacaagttgtggaagccca
aattatgctgccccagaggttatatctggaagattgtacgcaggacctgaggtggatgta
tggagctgcggtgttattttgtacgctcttctttgtggtactcttccatttgatgatgaa
aacattcccaaccttttcaagaaaataaagggtgggatatatactcttcctagtcattta
tcaactggtgctagagatctgatcccaaggatgctcatagttgaccctatgaagcgaatg
acaattcctgagattcgtcagcacccatggttccaagctcatcttcctcgctatttggct
gtacccccacctgacacaattcaacaagcaaaaaagattgatgaggagattcttcaggaa
gtggttaagatgggatttgacaggaatctacttgttgaatctcttcgcaacagagtacaa
aatgatgctaccgttgcatactatttgctattggacaaccgtttccgtgtttccagtggc
tatcttggagctgagtttcaggaatctttggaatatcaattcaatcgtagtgaagctgga
gctgttgggcagcggtttccaggatatgtggattatcaaggaatgggtttaagaacccag
ttcccagctgagaggaaatgggctcttgggcttcagtctcgagcccagcctagacagata
atgactgaagttctcaaagctctacaagaactgaatgtgtgttggaaaaagattgggcat
tacaacatgaaatgcaggtggattccaggcattcctgggcatcatgaaggcatggttaac
aatcctgtgcacagtaatcatttctttggggatgaaccagcaattgttgagaatgatggt
gtttccaggaatgtggtcaagtttgaagtgcagctttacaaaactcgagaggagaagtat
ctgcttgatctgcagagagttcagggcccacaattcctcttcttggatctttgtgcagct
ttccttgctcagctccgggtcctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system