KEGG   Vitis vinifera (wine grape): 100254398Help
Entry
100254398         CDS       T01084                                 

Definition
protoporphyrinogen oxidase, mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vvi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 508 aa AA seqDB search
MAEKSDAQSHYNGSGKRVAVVGAGVSGLAAAYKLKLHGVNITLYEAEERAGGKLRSVSQH
GLVWDEGANTMTESEIEVGSLLDNLRLREKQQFPISQNKRYIVRNGMPVLLPSNPIALIK
SNILSAKSKFQIILEPFLWKKSDLSKVSDDHMKESVGGFFQRHFGKEVVDYLIDPFVAGT
SGGDPESLSMHHTFPELWNLEKRFGSIIAGAVLSKLSAKREKRGETKGSSEKKKRQRGSF
SFQGGMQTLTDTLCKELGKDKLRLKSKVLSLSYSHGEKSALENWSVAYASNPGKQSKDLS
FDAVIMTAPLCNVREMKIMKKGNPFLLDFLPEVSYLPLSVIITTFKKENVKRPLEGFGVL
VPSKEQQNGLKTLGTLFSSMMFPDRAPNDLYLYTTFIGGSRNRELAKASTDELKQIVTSD
LRQLLGAEGEPTFVNHFYWSKAFPLFGHNYDSVLEAIDKMEKDLPGFFYAGNHKGGLSVG
KAIASGCKAADLVISYLNSSSDGKMFKE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaatcagatgcccagtcacactataatggttctggtaaaagagtggctgtt
gttggtgctggtgttagtgggcttgctgcagcatacaaattgaaattacatggcgtgaac
atcacattatatgaagctgaagaaagagctggtgggaaattaagaagtgtttcacaacat
ggtctagtttgggatgagggtgccaatacaatgacggagagtgagatagaggtcggaagc
ttgcttgataatcttaggcttcgagagaagcaacagtttccaatttcacagaacaagcgg
tatattgtaagaaatggaatgcctgtcctgttaccctctaatcctattgcgctgatcaag
agcaatatcctgtcagcaaaatccaagtttcagataattttggagccatttttgtggaag
aagagtgacctttcaaaggtgtctgatgatcatatgaaggaaagtgtgggcgggttcttt
cagcgtcatttcgggaaagaggttgttgattatttaattgacccttttgtggcgggtaca
agtggaggtgatcctgaatcactttctatgcatcatacttttccagagctatggaatctg
gaaaaaaggtttggttcaatcatagctggggcagttctgtccaagttatctgctaaaaga
gaaaaaagaggagaaacaaagggttcttcggagaaaaagaagcgtcagcgcggttcattt
tccttccagggtggaatgcagacgctcactgacacattatgcaaagagcttggcaaagac
aaacttagactcaagtcaaaggtgttgtcattatcttacagtcatggtgagaagtctgca
ttagagaattggtcagttgcttatgcttcaaaccctggaaagcaatcaaaagatttatct
tttgatgctgttatcatgacagctcctctctgtaatgttcgagaaatgaagatcatgaaa
aaaggaaaccccttcctgcttgactttcttcctgaggtgagttatttgccactgtcagtt
ataatcaccacctttaaaaaggagaatgtcaagaggccccttgagggatttggagttctt
gttccttccaaagagcaacaaaatggtttaaagaccctcggtacactcttttcctctatg
atgtttccagaccgtgctcccaatgacctatatctctatactaccttcattgggggaagt
cgaaaccgggaactagcaaaagcttcaacggatgagctcaagcagatagtcacctctgac
cttagacagttactgggtgcagagggggagccaacatttgtgaaccatttctactggagt
aaagcgtttccattatttgggcacaactatgattcagttctagaagccattgacaagatg
gaaaaagatcttccgggattcttctatgcaggtaaccataagggcgggctttcagttgga
aaagcaatagcctctgggtgcaaagcagctgatctcgtaatatcctacctcaactcttcg
tcagatggtaagatgttcaaggagtga

DBGET integrated database retrieval system