KEGG   Vitis vinifera (wine grape): 100254672Help
Entry
100254672         CDS       T01084                                 

Definition
probable glutathione peroxidase 8-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:vvi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:vvi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 170 aa AA seqDB search
MSKQIQQGPESIYDFTVKDAEGKSVNLSIYKGKVLLIVNVASKCGLTNSNYTELNQLYEK
YKDQGLEILAFPCNQFGEEEPGSNEQILEFVCTRFKSEFPVFDKIDVNGENAAPLYKFLK
SGKWGIFGDDIQWNFGKFLVDKNGKIVDRYYPTTSPLTVENDVKKLLEVS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaatacagcagggcccagaatcaatctatgacttcaccgttaaggatgct
gagggaaagagtgtgaatctgagcatttacaaggggaaagtcctactgattgtcaatgtt
gcctccaaatgtggattaaccaactcaaattacacagagctgaatcagttatacgagaag
tacaaagatcaaggcctagagatattggcatttccatgcaatcaatttggagaggaggaa
ccgggaagtaatgaacagatcttagagtttgtgtgcactcgcttcaaatcagaattcccg
gtctttgacaagattgacgtaaatggcgaaaatgctgctccactgtacaagttcttaaag
tcaggaaaatggggaatctttggggatgatatccagtggaactttggcaaattcctggtt
gacaaaaatgggaaaattgttgatcgttattacccaacaacttcccctctcaccgttgag
aatgatgtaaagaagttgttggaggtgtcttaa

DBGET integrated database retrieval system