KEGG   Vitis vinifera (wine grape): 100254672Help
Entry
100254672         CDS       T01084                                 

Definition
probable glutathione peroxidase 8-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100254672
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100254672
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100254672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 170 aa AA seqDB search
MSKQIQQGPESIYDFTVKDAEGKSVNLSIYKGKVLLIVNVASKCGLTNSNYTELNQLYEK
YKDQGLEILAFPCNQFGEEEPGSNEQILEFVCTRFKSEFPVFDKIDVNGENAAPLYKFLK
SGKWGIFGDDIQWNFGKFLVDKNGKIVDRYYPTTSPLTVENDVKKLLEVS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaatacagcagggcccagaatcaatctatgacttcaccgttaaggatgct
gagggaaagagtgtgaatctgagcatttacaaggggaaagtcctactgattgtcaatgtt
gcctccaaatgtggattaaccaactcaaattacacagagctgaatcagttatacgagaag
tacaaagatcaaggcctagagatattggcatttccatgcaatcaatttggagaggaggaa
ccgggaagtaatgaacagatcttagagtttgtgtgcactcgcttcaaatcagaattcccg
gtctttgacaagattgacgtaaatggcgaaaatgctgctccactgtacaagttcttaaag
tcaggaaaatggggaatctttggggatgatatccagtggaactttggcaaattcctggtt
gacaaaaatgggaaaattgttgatcgttattacccaacaacttcccctctcaccgttgag
aatgatgtaaagaagttgttggaggtgtcttaa

DBGET integrated database retrieval system