KEGG   Vitis vinifera (wine grape): 100254769Help
Entry
100254769         CDS       T01084                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100254769
   00051 Fructose and mannose metabolism
    100254769
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     100254769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 478 aa AA seqDB search
MMAGKVFLFLLCLNVVSFAVIASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPS
SKNPLSYKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFGAPTKFWPWEDGTDSLA
MAKRRMRANFEFIEKLGVDLWCFHDRDIAPDGKTLEEANANLDEVVALAKELQGKKIHPL
WGTAQLFHHPRYMHGGATSSEVAVYAYAAAQVKKAMEVTHYLGGENYVFWGGREGYQTLL
NTDMGRELDHLARFLEAAAAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATTANFLRKYG
LIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEA
TMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDGS
LENLVRKRYQSFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgggaaggtttttttgtttcttctttgtttaaatgtggtctcgtttgcagtg
attgcttccagtccacaaacttgccctgctgatgatgttagtagcaaatgtggtgcttca
gatgaatgggaaggggaatttttccccgggattcccaaaattaaatatgagggtccttca
agcaagaatcctctttcatacaagtggtataatgcagatgaggaaattcttgggaagaaa
atgaaggattggatgagattcagtgttgcattttggcacacattccgtggaaccggaggt
gatccatttggtgcacctacaaagttttggccatgggaagatggtactgattcattggct
atggccaagagaagaatgagagccaactttgagttcattgaaaagcttggagtcgatcta
tggtgcttccatgacagggatatagcccctgatggtaaaaccctggaggaagctaatgca
aacttggatgaagtggtcgccctagctaaagagcttcagggaaaaaagatccatcctttg
tggggtacagctcagttgttccatcatcctcgctatatgcatggtggtgctactagctct
gaagttgctgtgtatgcttatgctgccgctcaagtcaagaaagccatggaggttacacat
tatttaggtggagaaaactatgttttctggggtggtcgagaaggttatcaaactctattg
aacacagatatgggaagagagcttgatcatttggcaaggtttcttgaagctgctgctgca
tataagaagaagattgggtttaatgggactcttttgattgaacccaagcctcaagaacct
acaaaacaccagtatgactgggatgctgcaaccaccgctaatttcttacgaaaatatggt
cttataggggaatttaagctcaacattgaatgcaaccatgcaaccctatctggtcacagc
tgtcatcatgagcttgagactgcaagactcaatggtttactgggaaatattgatgctaac
actggcgaccctcaaattggttgggacacagatcagttccttacagatatagctgaggca
accatggttatgctcagtgtggtccgaaatggagggctggcccctggaggattcaacttt
gatgccaaattgcgaagggagagcactgatgttgaggatctcttcatttctcacattagt
ggaatggacaccctggcccgtggtctccgaaatgttgctaaattaattgaggatggctct
ttggagaatcttgttcgcaagcgatatcagagttttgacactgaaatcggggctcaaata
gaggctggtaaggctgattttgaaatgctagagaagaaagccatggaatggggagagcca
aaggttccttctgcgaagcaggaacttgcggagatgatattccaatctgcactgtag

DBGET integrated database retrieval system