KEGG   Vitis vinifera (wine grape): 100255167Help
Entry
100255167         CDS       T01084                                 

Definition
beta-amylase 2, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vvi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 554 aa AA seqDB search
MAFSPAHFFQSVWTLNAHSNVARAWLSPPVVSHTLSASRRLSSPFLISAQYNSRRLNGDF
VSSTVRSPISTKVTNGGEKTEDHPMDTVDDNKIADGPLKLQERDFAGTPYVPVYVMLPLS
VININCELVDPDGLVHQLRILKSINVDGVMVDCWWGIVEAHTPQVYNWSGYKRLFQIVHD
IQLKLQVVMSFHECGGNVGDDVHIPLPEWVREIGRSNPDIFFTDKEGRRNPECLSWGIDK
ERVLKGRTAVEVYFDYMRSFRVEFDEFFANGIISEIEIGLGPCGELRYPSYPANHGWKYP
GIGEFQCYDQYLSKSLTKAAEARGHLFWAKGPDNAGHYNSRPHETVFFCDGGKYDSYYGR
FFLNWYSRVLVDHGDRVLALANLAFEGTCIAVKLSGIHWWYKTASHASELTAGFYNPCNR
DGYAPISEMLQKHGAALNFTCVELRTLDQEEGFPEALADPEGLVWQVLNAAWDVSIPVAS
ENALTCHDREGYNKILENAKPFNDPDGRHLSAFTYLRLSPVLMETHNFTEFERFVKRMHG
EAVPDLACVTQPTT
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttctcccgctcattttttccagagtgtgtggactctaaatgctcattctaat
gttgcgagggcttggttatcgccacccgtggtatcacataccctatcagcttctcggaga
ctctcttctccattcttgatctctgcacagtacaattcgcgtcgcttaaacggagatttc
gtatcatctactgttcgttctccgatttcaactaaggtgacaaacggaggagagaaaact
gaggatcatcctatggatactgttgatgataataagattgcagatgggcccttaaagttg
caggagcgtgattttgctggtaccccatatgttcctgtatatgtgatgctacccctgagc
gttatcaatatcaactgtgagttggttgatccagatggtctggtacatcagctaaggatc
ttgaagtccattaatgttgatggtgttatggttgactgctggtggggaatagtagaagca
cacactccacaggtttacaattggagtggctacaagaggctctttcagattgtgcatgac
attcagcttaagttacaggttgttatgtcatttcatgaatgtggaggcaatgtcggtgat
gatgtacatattccactcccagaatgggttagagaaattggtcgaagcaatccagatatt
tttttcactgataaggaaggaaggcgtaaccctgaatgcctctcttggggaattgacaag
gagcgggttttaaaaggccgaactgcagttgaggtttactttgactacatgagaagcttc
cgggttgaatttgatgagttctttgcaaatggaatcatatctgagattgaaattggactt
ggtccatgtggggagttacgatatccgtcttatcctgcaaaccatggttggaaatatcct
ggtattggtgaattccagtgttatgaccagtacttatcaaagagtctgacaaaggcagca
gaggcaaggggtcatctattttgggctaaaggaccagataatgcaggtcactataattcc
cgtccacatgagacggtcttcttttgtgatggaggcaagtatgatagctactatggtaga
ttcttcctcaattggtactcacgggttttggttgatcatggtgatcgtgtacttgctcta
gccaatttagcttttgaaggcacttgcattgctgtaaagctatcaggtattcattggtgg
tacaagacagccagccatgcttctgaattgactgctgggttctataacccatgtaatcgt
gatggctatgctccaatttcagaaatgttacagaagcatggggctgctctgaacttcacc
tgtgttgaattacgcacactggaccaggaagagggcttcccagaggcactggcagaccca
gagggtctagtttggcaggtgctgaatgctgcatgggatgtcagcattccagttgctagt
gaaaatgctctaacttgccatgatagagaaggctataacaagatactagaaaatgccaag
cccttcaatgatcctgatgggaggcatttatctgcgtttacctacctcagactcagcccg
gttctcatggagacgcacaacttcacggagtttgaacgatttgttaagaggatgcacggg
gaagcggttcctgatctggcatgtgtgacacagcccactacttaa

DBGET integrated database retrieval system