KEGG   Vitis vinifera (wine grape): 100255551Help
Entry
100255551         CDS       T01084                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 2
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100255551
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100255551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1036 aa AA seqDB search
MGKKVKKKGRTGHKEKRGSASSLKIVPQQCNPSSETVADGNTVVKGREPCIHFNKGVDLG
KISAKFGLPEPIRCEDCREGTIDRRGNRAKGKHGKKGVGSVDSKSESKAIWVCLECGHFA
CGGVGLPTTPQSHAVRHARLTRHPLVIQFENPHLRWCFPCKMVIPVDKMEANDMLLDIVK
LVKGRSVKGPSVDGEDVWYGGGSVKNEKTPDNNLEIIPDNTLSGDLDERDSYVVRGLINI
GNTCFFNSIMQNLLAMNNLRDYFLKLDGSIGPLTSAFRKVFDETSSGTGLRNVINPKSVF
GCVCAKAPQFRGYQQQDSHELLRCLLDGLCTEELGARKRANSSQEDGISPNEAPTFVDTM
FGGQISSTVCCVECGHSSTVYEPFLDLSLPVPTKKPPSRKTQPVSRPKKTKLPPKKAGRV
RSKVNKDADSLVALSVQHPSSDGDSSNQIQSSAPVAEKLVSSSGDSAGSDLVSPCAVADV
KDSVSKNISTSEEFENKQVFENVTETKAAPSDDFTLLDCSDTFTWLDYLDPGAVLDVHNV
ASQNKDVSVIQDSGNQDNVQNDVLLQNASEFSSQVYPHKGEPNLKIDSCSANSWEEELPV
QIQSSEVLLLPYKEETSTAVEITTGQVGPSVVSGSNEELLDFDGFGGLFDEPEAASGVNL
QPLLGDNSFNANEVVGTGFINRNSSESDPDEVDNSNSMVSIDSCLTYFTKPELLSNEHAW
HCENCSKILWDQRIKTRTNLPNTISKIQMNGSEGKIQNGPFGLCKDISPDEVKDIDNENV
KNDGHNILGGLAPHDRISDDDSKQNGLKLQTSQTVEVNPVVSQCEGGKSKMNYALPELSH
SSDTYKTCSQASLSDPASDSCSVHEPNSVGCNTGKQRNSQMLTGELESEEDEDKEMDSES
VKVKRDATKRILINKAPPILTIHLKRFSQDARGRYNKLNGHVVFKDSIDLRPFMEPRCVE
KGKYEYRLVGVVEHSGSMRMGHYVAYVRGGERRSSGQAKKESGRGVWYYASDASVRETSL
DEVLRCEAYILFYEKI
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaaggtcaagaagaaaggccgaactggccacaaggagaagaggggttcggcc
tcttcactgaaaattgttccccaacaatgtaatccaagttctgagactgttgctgatgga
aatacagtggtcaaagggagagaaccatgcatccattttaacaagggtgttgatttgggt
aaaatctcggcaaaatttgggttgccagaacctattcgttgtgaagactgcagggaagga
actattgataggcggggcaatagagctaagggtaaacatgggaaaaaaggagtgggttcc
gtggattcaaaatcggagtcaaaagctatttgggtctgtttggaatgtgggcattttgcc
tgtggaggtgttggattgccaacaacccctcagagccatgcagttcgtcatgccaggcta
actcgtcaccccctggtgatccaatttgaaaaccctcatctccgctggtgcttcccatgc
aaaatggtaattccagttgacaaaatggaagcaaatgatatgttattggacattgtgaaa
ttggtaaaggggcgatctgtgaaggggccgtccgtagatggtgaggatgtttggtatgga
ggtggcagtgtcaagaatgaaaaaacaccagataacaaccttgaaataataccagataac
actctttcaggtgatttagatgaaagagattcttacgtagtaagaggcttgatcaacatt
ggcaatacttgcttttttaattcaattatgcaaaatcttctggcaatgaacaatttgcgg
gattacttcttgaagctggatggttctatagggcctcttactagtgcatttaggaaggtc
tttgatgagacaagttcgggcacaggattgagaaacgtaataaatccaaaatctgttttt
gggtgtgtatgtgccaaggctccccagtttaggggatatcagcagcaggacagtcatgaa
ttgctccgttgtttactcgatggattgtgtactgaagagttgggtgccagaaaacgggca
aactcctctcaagaagatgggatttcaccaaatgaggctcctacttttgtggatacaatg
tttgggggccaaatatccagtactgtttgttgtgtggaatgtgggcactcctcaacagtg
tatgagccatttttggatctctcgcttccagttccaacaaagaagcctccatctaggaag
acccaaccagtatctcgccctaagaaaacaaagctgccaccaaagaaagctggaagggtt
cgttcaaaagtaaacaaggatgcagattctctagtggctctaagcgttcaacacccatca
tctgatggtgattcttccaaccaaattcaatctagtgcacctgttgcagaaaaattggtg
tcatcttcaggtgattctgcggggtcagatttagtttccccatgtgccgtggctgatgtc
aaggattcagtttcaaagaatatctctacttcggaagaatttgagaacaagcaagtcttt
gagaatgttactgagaccaaagctgcaccatcagatgattttacattgttggattgctct
gatacttttacatggttggattaccttgatccaggagcagtattggatgttcataatgtg
gcttcacaaaataaagatgtttcagttattcaagattcagggaaccaggataatgttcag
aatgatgtcttattgcaaaatgcctctgaatttagtagtcaggtttatccacacaaggga
gagccaaatctaaaaatagattcttgttctgcaaattcatgggaagaagaactcccagtg
caaattcaaagttctgaagttttgctgcttccctacaaggaagaaacatcaactgctgta
gagatcacaacaggacaagttgggccttcagtagtttcaggctccaatgaagagttattg
gattttgatggttttggtggcttatttgatgagcctgaggcagcttcaggggtaaatttg
caaccattgttaggcgataacagcttcaacgcaaatgaagttgtgggaactggtttcata
aatagaaacagcagcgagtctgatccagatgaagttgataattccaattccatggtgtca
atagatagttgtctgacctattttacaaagccagagcttctctccaatgaacatgcttgg
cattgtgagaattgttcaaaaattttgtgggaccagaggataaaaacaaggaccaacctg
ccaaatactatatctaagattcagatgaatggaagtgagggtaagattcaaaatggccca
tttggtttgtgcaaggacatctctcctgatgaagtcaaagacattgataatgaaaatgta
aaaaatgatggtcataatattctgggtggcttggcaccacatgacaggataagtgatgat
gattcaaagcaaaacggcctaaaactccaaaccagccaaacagttgaggtgaacccagtt
gtttctcaatgtgaaggaggaaaaagcaagatgaactatgctcttccagagctatcacat
tcttcagatacttataaaacctgcagtcaagcaagcttaagtgatccagccagtgattca
tgtagtgttcatgagcctaatagtgttggatgtaacactggtaagcaaagaaattcacag
atgttaactggggagcttgaatcagaagaagatgaggacaaggagatggattctgaaagt
gtaaaagtgaagagggatgcaactaaaaggattctcattaataaggcaccacctattctg
accattcacctgaagaggttcagccaagatgctcgtgggcgctataataaattgaatgga
catgtggttttcaaagattcaattgatcttaggccatttatggaacccaggtgtgtagag
aaaggaaaatatgaatatcggctggttggagtagtggagcattctggaagcatgagaatg
gggcactatgttgcatatgtgagaggaggggagaggaggagcagtgggcaggctaaaaaa
gaaagtggacggggtgtgtggtattatgctagtgatgcttctgtgcgtgaaacttccctg
gatgaagttcttcgatgtgaggcctacatcttgttctatgaaaagatataa

DBGET integrated database retrieval system