KEGG   Vitis vinifera (wine grape): 100255551Help
Entry
100255551         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 950 aa AA seqDB search
MGKKVKKKGRTGHKEKRGSASSLKIVPQQCNPSSETVADGNTVVKGREPCIHFNKGVDLG
KISAKFGLPEPIRCEDCREGTIDRRGNRAKGKHGKKGVGSVDSNRVKLLDVWYGGGSVKN
EKTPDNNLEIIPDNTLSGDLDERDSYVVRGLINIGNTCFFNSIMQNLLAMNNLRDYFLKL
DGSIGPLTSAFRKVFDETSSGTGLRNVINPKSVFGCVCAKAPQFRGYQQQDSHELLRCLL
DGLCTEELGARKRANSSQEDGISPNEAPTFVDTMFGGQISSTVCCVECGHSSTVYEPFLD
LSLPVPTKKPPSRKTQPVSRPKKTKLPPKKAGRVRSKVNKDADSLVALSVQHPSSDGDSS
NQIQSSAPVAEKLVSSSGDSAGSDLVSPCAVADVKDSVSKNISTSEEFENKQVFENVTET
KAAPSDDFTLLDCSDTFTWLDYLDPGAVLDVHNVASQNKDVSVIQDSGNQDNVQNDVLLQ
NASEFSSQVYPHKGEPNLKIDSCSANSWEEELPVQIQSSEVLLLPYKEETSTAVEITTGQ
VGPSVVSGSNEELLDFDGFGGLFDEPEAASGVNLQPLLGDNSFNANEVVGTGFINRNSSE
SDPDEVDNSNSMVSIDSCLTYFTKPELLSNEHAWHCENCSKILWDQRIKTRTNLPNTISK
IQMNGSEGKIQNGPFGLCKDISPDEVKDIDNENVKNDGHNILGGLAPHDRISDDDSKQNG
LKLQTSQTVEVNPVVSQCEGGKSKMNYALPELSHSSDTYKTCSQASLSDPASDSCSVHEP
NSVGCNTGKQRNSQMLTGELESEEDEDKEMDSESVKVKRDATKRILINKAPPILTIHLKR
FSQDARGRYNKLNGHVVFKDSIDLRPFMEPRCVEKGKYEYRLVGVVEHSGSMRMGHYVAY
VRGGERRSSGQAKKESGRGVWYYASDASVRETSLDEVLRCEAYILFYEKI
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaaggtcaagaagaaaggccgaactggccacaaggagaagaggggttcggcc
tcttcactgaaaattgttccccaacaatgtaatccaagttctgagactgttgctgatgga
aatacagtggtcaaagggagagaaccatgcatccattttaacaagggtgttgatttgggt
aaaatctcggcaaaatttgggttgccagaacctattcgttgtgaagactgcagggaagga
actattgataggcggggcaatagagctaagggtaaacatgggaaaaaaggagtgggttcc
gtggattcaaatcgagtcaagctattggatgtttggtatggaggtggcagtgtcaagaat
gaaaaaacaccagataacaaccttgaaataataccagataacactctttcaggtgattta
gatgaaagagattcttacgtagtaagaggcttgatcaacattggcaatacttgctttttt
aattcaattatgcaaaatcttctggcaatgaacaatttgcgggattacttcttgaagctg
gatggttctatagggcctcttactagtgcatttaggaaggtctttgatgagacaagttcg
ggcacaggattgagaaacgtaataaatccaaaatctgtttttgggtgtgtatgtgccaag
gctccccagtttaggggatatcagcagcaggacagtcatgaattgctccgttgtttactc
gatggattgtgtactgaagagttgggtgccagaaaacgggcaaactcctctcaagaagat
gggatttcaccaaatgaggctcctacttttgtggatacaatgtttgggggccaaatatcc
agtactgtttgttgtgtggaatgtgggcactcctcaacagtgtatgagccatttttggat
ctctcgcttccagttccaacaaagaagcctccatctaggaagacccaaccagtatctcgc
cctaagaaaacaaagctgccaccaaagaaagctggaagggttcgttcaaaagtaaacaag
gatgcagattctctagtggctctaagcgttcaacacccatcatctgatggtgattcttcc
aaccaaattcaatctagtgcacctgttgcagaaaaattggtgtcatcttcaggtgattct
gcggggtcagatttagtttccccatgtgccgtggctgatgtcaaggattcagtttcaaag
aatatctctacttcggaagaatttgagaacaagcaagtctttgagaatgttactgagacc
aaagctgcaccatcagatgattttacattgttggattgctctgatacttttacatggttg
gattaccttgatccaggagcagtattggatgttcataatgtggcttcacaaaataaagat
gtttcagttattcaagattcagggaaccaggataatgttcagaatgatgtcttattgcaa
aatgcctctgaatttagtagtcaggtttatccacacaagggagagccaaatctaaaaata
gattcttgttctgcaaattcatgggaagaagaactcccagtgcaaattcaaagttctgaa
gttttgctgcttccctacaaggaagaaacatcaactgctgtagagatcacaacaggacaa
gttgggccttcagtagtttcaggctccaatgaagagttattggattttgatggttttggt
ggcttatttgatgagcctgaggcagcttcaggggtaaatttgcaaccattgttaggcgat
aacagcttcaacgcaaatgaagttgtgggaactggtttcataaatagaaacagcagcgag
tctgatccagatgaagttgataattccaattccatggtgtcaatagatagttgtctgacc
tattttacaaagccagagcttctctccaatgaacatgcttggcattgtgagaattgttca
aaaattttgtgggaccagaggataaaaacaaggaccaacctgccaaatactatatctaag
attcagatgaatggaagtgagggtaagattcaaaatggcccatttggtttgtgcaaggac
atctctcctgatgaagtcaaagacattgataatgaaaatgtaaaaaatgatggtcataat
attctgggtggcttggcaccacatgacaggataagtgatgatgattcaaagcaaaacggc
ctaaaactccaaaccagccaaacagttgaggtgaacccagttgtttctcaatgtgaagga
ggaaaaagcaagatgaactatgctcttccagagctatcacattcttcagatacttataaa
acctgcagtcaagcaagcttaagtgatccagccagtgattcatgtagtgttcatgagcct
aatagtgttggatgtaacactggtaagcaaagaaattcacagatgttaactggggagctt
gaatcagaagaagatgaggacaaggagatggattctgaaagtgtaaaagtgaagagggat
gcaactaaaaggattctcattaataaggcaccacctattctgaccattcacctgaagagg
ttcagccaagatgctcgtgggcgctataataaattgaatggacatgtggttttcaaagat
tcaattgatcttaggccatttatggaacccaggtgtgtagagaaaggaaaatatgaatat
cggctggttggagtagtggagcattctggaagcatgagaatggggcactatgttgcatat
gtgagaggaggggagaggaggagcagtgggcaggctaaaaaagaaagtggacggggtgtg
tggtattatgctagtgatgcttctgtgcgtgaaacttccctggatgaagttcttcgatgt
gaggcctacatcttgttctatgaaaagatataa

DBGET integrated database retrieval system