KEGG   Vitis vinifera (wine grape): 100255882Help
Entry
100255882         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100255882
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100255882
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100255882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 553 aa AA seqDB search
MSKQNPSYTNPKPCKHLADYKLRHGLNGFKTLQNCLKTTPYGRTSVSKHKSETPRCSLCF
GYQGRLYFCLICSSITCSSHANEHSQSHHGHEIAVDVERAELYCCVCRDQVYDPDFDRAV
VSKHFMDMPSNVNGVEGVVEESNKRRRLGLGLELEWKRSKRLISMADRRAKSIFPLGLRG
LNNLGNTCFMNSVLQALFHAPPLRNYFLSDRHNRQSCRRRSSDRLCLPCDIDVIFSAVFS
GDRTPYSPARFLYSWWQHSENLASYEQQDAHEFFISMLDQIHVKEGKSGNQDKDNRDCQC
IAHKAFSGLLRSDVTCTTCGFTSTTYDPCVDISLNLDMSFCPSTGMTNRTTKPNENAIIS
TLLGCLDLFTRPEKLGPDQKLYCQNCQERRNSLKQMSIRRLPIVLCLHIKRFEHSTIRKM
SRKIDQYLQFPFSLDMTPYLSSSIVRNRFGNRIFTFEGDESETCTEFEVFAVVTHSGMLE
SGHYVTYVRVRNRWYKCDDAWITEVDEGVVRASQCYLMYYVQKGFYYKASEDLSCLPMSP
PGGESYLPIAGCC
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaaaacccctcatacacaaaccctaaaccctgcaaacaccttgcagattac
aagctcagacatggcttgaatggcttcaaaaccctccaaaactgccttaaaacgacccca
tatggaagaacaagtgtgagcaaacacaaatcagagacacccagatgcagtttgtgtttt
gggtatcaaggtagactctatttctgcttgatttgttcttcaatcacatgttctagtcat
gcaaatgagcattcccaatcgcaccacggccatgagattgctgtggacgttgaaagggcc
gagctttactgctgtgtgtgccgtgatcaggtgtatgatcctgattttgatagggctgtg
gtgagcaaacacttcatggatatgcccagcaatgtaaatggggtggagggtgttgtggag
gagtcgaataagaggaggagattgggtttagggttagaattggagtggaagaggtcgaaa
aggctgatttcgatggctgatcggagggcgaaatcaatatttccattgggtttgagggga
ttgaacaatctgggaaatacttgcttcatgaattctgtgttgcaagcattgtttcatgct
ccacctcttaggaattacttcctaagtgaccgccacaaccgccaatcttgccggagaagg
tcctcagatcgcctttgtttgccttgtgacattgacgttatcttctcagccgtgttttcc
ggtgatcggactccttacagtcctgctcggtttctttacagttggtggcagcattcagaa
aatctagctagttatgaacagcaagatgctcatgagttcttcatttcaatgcttgatcaa
atccatgtgaaagaaggaaaatcaggaaaccaagataaagataacagagattgccagtgt
attgctcataaagcgttctctgggctgttgagatcagatgtcacttgtacaacctgcgga
tttacttcgacaacctatgacccatgtgtggacatttctcttaacttggacatgagcttt
tgcccttcaacaggcatgaccaacaggaccaccaagccaaatgagaatgcaattatatct
actctcttgggctgcttggacctcttcacaagaccagagaagttgggtccagaccagaaa
ttgtactgccaaaactgtcaagaaaggcgaaactcattgaagcaaatgtccatcagaagg
ctcccaatagtactatgtctacatataaagcgatttgagcactcaacaatcagaaaaatg
tcacggaaaattgaccaatatctgcagttccccttctccttggacatgactccatactta
tcctcctccattgtcaggaacaggtttggaaacagaatctttacttttgagggagacgaa
tcggaaacttgtacagaatttgaggtttttgctgtggttactcattcagggatgctagaa
tctgggcattatgtgacttacgtccgtgtaagaaatcgatggtacaaatgtgacgatgcc
tggattactgaagttgatgaaggggtggtgagggcttcacaatgctacttgatgtattat
gtgcagaaagggttttactataaagctagtgaagatttaagttgcctgcccatgtcccct
cctgggggagaatcctatcttccaattgccggttgttgctaa

DBGET integrated database retrieval system