KEGG   Vitis vinifera (wine grape): 100256135Help
Entry
100256135         CDS       T01084                                 

Definition
cell division cycle protein 27 homolog B-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100256135
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100256135
Ubiquitin system [BR:vvi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100256135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 761 aa AA seqDB search
MEAILVDSVLGSLRHFLHRNAIFICERLCAEFPSETNLQLLASCYLHNNQAYAAYYILKG
TQMAQSRYLFAISCFQMDLLTEAEAALCPVNEPGAEIPNGAAGHYLLGLIYRYTDRKKSA
VHHFKQALSLDPLLWAAYEELCLLGAAEEATAVFGEAAALCIQKQHLHHGLASQNLQTSI
EDRNLVSGRNLSSEDVSPRQLKHIHANNLREIPGNYHGAAMSGATASQSLNSGPSSTAFY
NTPSPMVAQLSGVAPPPLCRNVQQNGLNPSTVGNDSSPRSTVNPTIQAPRRKFVDEGKLR
KISGRLFSDSGPRRSTRLAGEAGANTNPSGTTVAGNGTIHSSKYLGGAKSSSAAFRSVTV
RKGQTLANESFDEGTRQEVFDDSRSYISAATSTSTSTSGDPKSLEQDEATMTIGGVITNT
SKIINGAAEVLNLLRTLGEGYRLSCMYRCQDALDVYMKLPHKHYNTGWVLSQIGKAYFEL
VDYLGADRAFSSARQASPYSLEGMDIYSTVLYHLREDMKLSYLAQELISTDRLAPQSWCA
MGNCYSLQKDHETALKNFQRAVQLNSRFAYAHTLCGHEYVALEYFENGIKSYQSALRIDD
RHYNSWYGLGMICLRQEKFEFAEHHFRMAFQINPRSSVILCYLGTALHALKRSGEALYMM
EKAILADKKNPLPMYEKANILLGLDNFDEALEVLEELKEYAPRESSVYALMGKIYKRRNM
YDKAMLHFGIALDLKPSAADVATIKAAIEKLHVPDEIEDNL
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatactcgtcgattctgtgctcggcagtctccggcatttcctgcaccgaaat
gccattttcatatgcgaacgtctctgcgctgagtttccatccgaaacaaatttgcaatta
ttggccagctgttacttgcacaacaatcaggcttacgcggcatactatattttaaaagga
acacaaatggctcaatcccgctacctgtttgcaatatcgtgctttcagatggatcttctg
acagaagctgaagcagcactgtgtcctgtcaatgagcctggtgctgagattccaaatggt
gcagctggtcattaccttcttgggcttatttacaggtacactgatagaaagaagagtgcc
gttcaccactttaagcaggctttgtctttagatcctttactctgggctgcttatgaggag
ctctgtttattaggtgctgctgaagaagcaactgcagtttttggtgaagcagctgctctt
tgcatccaaaagcagcatctacatcatggattggcatcccagaacttgcagacatccatt
gaggatcgcaatttagtctctggtaggaacttgagttctgaagatgtcagtccaagacaa
ttgaagcacatacatgctaataacctaagagaaatccctggaaattatcatggagcagct
atgtcgggagcaactgctagtcagtctctaaatagtggtccttctagcacagcattttat
aatactccttcaccaatggttgcacagttgtcaggtgttgctccaccaccactgtgtaga
aatgtgcagcaaaatggcctaaacccaagcacagttggtaatgatagctctccaaggtca
actgttaaccctaccattcaagcccctcgaagaaagtttgttgatgagggaaaattacgc
aagatctcagggaggttattttctgattctggccctagacgaagtacaaggctcgctgga
gaagctggtgccaacacaaacccaagtggcacaacagtagctggaaatggaactattcac
tcttctaagtatcttggaggtgccaaatcgagttctgcagcatttcgttctgtcacagtt
cgtaagggacagactttggctaatgaaagttttgatgaaggaacacgccaggaggttttt
gatgattctcgttcctatatctcagcggcaacatcaacgtcaacttcaacttctggtgat
cctaaatcccttgaacaagatgaagcaaccatgacaattggtggggttatcacaaatacc
tcaaaaatcataaatggtgctgctgaagtactgaatctcttgagaactcttggggaaggc
tatagactttcctgtatgtataggtgccaggatgcgctggatgtctatatgaaacttcca
cacaagcattataatactggttgggtgctttctcagattggaaaagcatattttgaactg
gttgattatttaggggctgaccgtgcattcagtagtgcccgtcaagcatctccttatagt
ttagaaggaatggatatatattctacagttctttatcatttgagggaagatatgaagcta
agttacctggctcaagaactaatatccacagatcgcttagctcctcagtcttggtgtgcc
atgggaaattgctatagtttgcagaaagaccatgaaactgctctaaagaatttccagcgt
gcagtgcaactaaattcaagatttgcatatgcgcacaccctttgtggtcacgagtatgta
gccttagagtattttgagaatggaattaagagctatcagagtgcccttcggattgatgat
aggcattataactcctggtatggtcttggaatgatctgtcttcgccaagagaagtttgag
ttcgcagagcatcactttagaatggctttccaaatcaatccacgttcttcagttattttg
tgttatcttgggacggctttgcatgcattaaagagaagtggggaagctttgtacatgatg
gagaaggctattctagcagataagaagaatcctcttcccatgtatgagaaggctaacata
cttttgggcttggataactttgatgaagccttagaagtcctagaggagcttaaagagtat
gctccgcgtgaaagcagtgtgtatgccttgatgggtaagatttataagcgacgcaacatg
tatgacaaggccatgcttcattttggaattgctttggatttgaaaccatctgcagcagat
gttgctaccatcaaggctgccatcgagaagctgcatgtaccagatgagattgaagacaac
ttatag

DBGET integrated database retrieval system