KEGG   Vitis vinifera (wine grape): 100256415Help
Entry
100256415         CDS       T01084                                 

Definition
protein disulfide isomerase-like 1-3-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100256415
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100256415
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100256415
  Exosomal proteins of colorectal cancer cells
   100256415
  Exosomal proteins of bladder cancer cells
   100256415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 561 aa AA seqDB search
MAGRVVMILSILILLPFVAFSLSKADEPEDLTLLQSQDQNDVVSPPPDPNRFNGGGGGDD
DDLSDSDGAGGDDDSDREVVDEKDVVVLKEANFSEFLERNPYVMVEFYAPWCGHCKALAP
EYAEAATELKGEAVLAKVDGTEESGLMDKYEVQGFPTLYFYADGVHKAYSGLRTKDAIVA
WVKKKMESGIHNITTTVEAESILTTESKIVLGFLDSLEGPESQELAAASRLEDDVNFYQT
ASPEVAKLFHIDQQVKRPALVLLKKEAEKLSHFDGQFIKSAIAEFVFANKHPLVIIFTKE
SSRQIFENPIKKQLLLFATSKDSENVLPQFQEAAKAFKGKLIFVYVEMDNKDGKSVADYF
GVTGDAPRVLAYTGNDDAKKYVLDGELTLTSIKSFGEDFLEDKLKRFYKSDPIPETNDGD
VKIVVGDNFDELVLDESKDVLLEIYDPSCGYCQALEPTYNKLAKYLRGIDSLVIAKMDGT
KNEHPRAKTDGFPTILFFPAGNKSFDPITFDGDRTLVAFYKFLKKYASIPFKLKKPASYQ
SSKGAEAKDGNESNNSVKDEL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagagtggttatgattttatcaatcttaattcttcttcccttcgttgccttt
tccctctccaaagccgacgaaccagaagatctcactctgctccaatcccaagaccaaaac
gacgtcgtatcgcctcctccagatccaaaccgcttcaacggcggcggcggcggcgatgac
gatgacctatccgattcagacggtgccggcggcgacgacgactcggatcgcgaggtggtg
gacgagaaggatgtcgtggtgttgaaggaggcgaatttcagcgagttcctggagaggaat
ccctacgtgatggttgaattctatgcgccgtggtgcggccattgcaaggctctggcgccg
gagtatgcggaggcggcgactgagttgaagggagaggcggtgctcgccaaggttgatggt
acggaggagagtgggctcatggacaagtatgaggtgcaggggtttccgactttgtatttc
tatgctgatggagttcataaggcctattctggactgaggactaaagatgctattgtggct
tgggttaagaagaagatggagtctggcatccacaacataacaacaacagtggaggcagaa
agcatattgactacagaatcaaaaattgttttggggttcctggacagtttagagggtcca
gagagtcaggagttggctgctgcttcaagattggaagatgatgtcaacttctatcaaact
gctagtccagaggtggcaaagcttttccacattgatcaacaagtcaaacgtcctgcactg
gtattgctaaagaaggaggctgaaaaattgagccactttgatggtcagtttatcaaatcg
gctatagctgagtttgtatttgcaaacaagcatcctttggtaatcatttttactaaggaa
agttctcggcagattttcgaaaatccaattaaaaaacagttgttgctttttgccacttca
aaggattcagagaatgttctacctcaatttcaagaagcagcaaaagctttcaagggaaag
cttatttttgtgtatgtggaaatggacaacaaggatggtaaatcagttgcagattacttt
ggtgtaactggagatgctccaagagttcttgcatacacaggaaatgatgatgccaagaag
tatgtattggatggtgaattaaccttgaccagtattaagtcatttggcgaagatttcttg
gaagacaagcttaagcgtttttacaagtcagacccaatcccagagacaaatgacggggat
gtaaaaattgttgtcggtgataatttcgatgaacttgttttggatgaatcaaaggatgtt
cttcttgagatatatgatccctcgtgtgggtattgccaagcattggaaccaacatacaac
aagcttgccaagtatttgagaggcattgattcacttgttatagctaagatggatgggaca
aaaaatgagcacccaagagcaaagactgatgggttccctacaattcttttcttcccggct
gggaataagagctttgatccgatcacttttgatggtgaccgtactttggtggcattctat
aagttccttaagaagtatgcatccatccctttcaagctcaaaaaaccagcttcataccag
agctccaagggtgctgaggccaaggatggcaatgagagcaataacagtgtcaaggatgaa
ttgtga

DBGET integrated database retrieval system