KEGG   Vitis vinifera (wine grape): 100256426Help
Entry
100256426         CDS       T01084                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100256426
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100256426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 561 aa AA seqDB search
MAEAKTVHSPALTYFSMISLLTLCPPFVILLWYTMVHADGSVLQTWDYLKQHGVQGFIDI
WPRPTAIAWKLIACYAAFEAALQLFLPGKTVEGPISPCGNRPVYKANGMQAYAVTLITYL
SLWWFGIFNPAIVYDHLGEIYSALIFGSLIFCIFLYIKGHVAPSSTDSGSSGNIIIDFYW
GMELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQYEENGKVADSMLVNTILMLVYV
TKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYLVNHPVNLGTQLAIYIL
AAGITCIYINYDCDRQRQEFRRTNGKCLVWGKAPSKIVASYTTTSGETKSSLLLTSGWWG
LSRHFHYVPEILAAFFWTVPALFGHFLPYFYVLFLTILLFDRAKRDDDRCRSKYGKYWKK
YCEKKMSSYDNVIGGKLKLKGKALDVKAGGVKKKKKHKKQYDQNSEVTENELSADGSTRL
STDPNEEDPNDANKSSGEKNAAPYDDHLTPAERRYIEQREKLDVNRLARISNKSHRDRIQ
DFNQYLANMSEHYDIPKVGPG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgaagacggtgcactcaccggcgttgacgtacttttccatgatatcgctt
ctcactctctgccctcccttcgtcattctactatggtatacaatggttcatgctgatggg
tctgtattgcaaacttgggactacctaaagcagcatggggtgcaagggttcatagacatc
tggccaaggccaactgcgattgcatggaaactaattgcttgttatgctgcatttgaagct
gcacttcagctttttctacctggtaaaacagttgagggcccgatatctccttgtgggaat
cggcctgtttacaaggcaaatggcatgcaagcatatgcagtaacattgattacttatctg
agtctgtggtggtttggcatattcaaccctgcaattgtttatgatcatctgggagaaata
tattcagcacttatttttggaagtttgatcttttgtattttcttatacataaaaggtcat
gtggcaccatcttcgactgattctggttcatctggcaacataataatcgatttctattgg
ggtatggagctgtatccccgaattggtaagaactttgacatcaaggttttcacaaactgc
cgatttgggatgatgtcttgggcagttcttgctgtgacctattgtataaagcagtatgaa
gagaatgggaaagtggcagattccatgcttgtaaatactatattgatgctggtatatgtg
acaaagttcttttggtgggaagctggatactggaacacaatggatattgcacatgatcga
gctggcttttatatttgttggggatgcttggtatgggttccgtccatttacacttctcct
ggaatgtacctggtcaaccatcctgtgaaccttggaactcagcttgcgatttatattctt
gcagctggaatcacatgcatatatataaactatgattgtgataggcaaaggcaagaattc
cgtagaacaaatggcaagtgcttggtttgggggaaagctccatcaaagattgtggcctcc
tacaccaccacttctggagaaacaaagtccagtcttcttttgacctcgggctggtggggt
ttgtcccgtcacttccattatgtacctgaaattttggctgcatttttctggacggtccct
gctctttttggccattttctgccttatttctacgtgctgttccttactatccttcttttt
gaccgagccaaaagggatgatgatcgatgtcggtccaagtacgggaaatactggaaaaaa
tactgtgaaaagaaaatgtcctcatatgataatgttattggagggaagctaaagctaaag
ggaaaagccctggatgtgaaggctggtggagtgaagaaaaagaagaaacacaagaagcag
tatgatcaaaattctgaagtcaccgaaaatgagctttcagcagatggaagtacaagatta
tcaactgatcccaacgaggaagatccaaatgatgccaacaaatcgagtggagaaaaaaat
gctgctccatatgatgatcatctcacgccagctgagagacgatacatagagcagagagag
aaactggatgtgaacaggctggccaggatatctaataaatcacacagggatcggatccag
gactttaaccagtacctggcaaacatgagcgagcattacgacatccctaaagttggacct
ggctaa

DBGET integrated database retrieval system