KEGG   Vitis vinifera (wine grape): 100256972Help
Entry
100256972         CDS       T01084                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100256972
Exosome [BR:vvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100256972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 1704 aa AA seqDB search
MAAANAPITMKEVLTLPSLGISPQFITFTHVTMESDKYLCVRETAPQNSVVIIDMNMPMQ
PLRRPITADSALMNPNTRILALKAQLPGTTQDHLQIFNIEMKAKMKSYQMPEQIVFWKWI
TPKMLGLVTQTSVYHWSIEGDSEPVKMFERTANLVNNQIINYRCDPSEKWLVLIGIAPGS
PERPQLVKGNMQLFSVEQHRSQALEAHAASFATFKVPGNDQPCTLIGFATKSFNAGQIVS
KLHVIELGSNPGKPGFTKKQADLFFPPDFADDFPVAMQISHKYGLIYVITKLGLLFVYDL
ESASAVYRNRISPDPIFLTAEATSIGGFYAINRRGQVLLATVNEAAIVPFVSGQLNNLEL
AVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPMQ
SGQTPPLLQYFGTLLTRGKLNAFESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDTDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRSDPQ
GAVNFALMMSQMEGGCPIDFNTITDLFLQRNLIREATAFLLDVLKPNLPEHGFLQTKVLE
INLVTYPNVADAILANGMFSHYDRPRIAQLCEKAGLYVRALQHYTELPDIKRVIVNTHAI
EPQALVEFFGTLSREWALECMKDLLLVNLRGNLQIIVQTAKEYSEQLGVDQCVKLFEQFK
SYEGLYFFLGSYLSSSEDPDIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPSNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDSDLWEKVLDPDNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLFE
EAFAIFKKFNLNVQAVNVLLDNIQSIERAVEFAFRVEEDAVWSQVAKAQLREGLVSDAIE
SFIRADDATQFLDVIRAAEDANVYHDLVRYLLMVRQKAKEPKVDSELIYAYAKIDRLGEI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIFAFISNWAKLACTLVKLRQFQGAVDAARK
ANSSKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSDYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYDEFDNAATTIMNHSPDAWDHMQFKDVAVKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRVDHTRVVDIMRKAGHLHLVKPYMVAVQSNNVSAVNEALNGIYVEEEDYDRLRESIDM
HDNFDQIGLAQKIEKHELLEMRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGD
RELAEELLVYFIEKGKKECFASCLFVCYDLIRPDIALELAWINNMVDFALPYLLQFIREY
AGKVDELVKDKLEALNEVKAKEKEEKDVIAQQNMYAQLLPLALPAPPMPGMGGAGMAGGF
VPPPMGSMGMPPMPPFGMPPMGTY
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcaaacgcccctatcaccatgaaggaggttctgacgttgccgagtttggga
attagtcctcagtttataacgtttacacatgtcacgatggaatctgataagtatctatgc
gttcgggagacggctccacagaacagtgttgtaatcattgatatgaatatgccaatgcag
cctttgagaaggccgatcactgcggactcggcgctaatgaatcccaataccagaattctt
gcattgaaagctcaacttccgggaaccacccaggatcacttgcaaatatttaatattgag
atgaaagccaaaatgaaatcatatcaaatgcctgagcagattgttttctggaagtggatt
accccaaagatgctgggcctggtcacgcagacctcagtatatcattggtcaatcgaaggt
gattctgaacctgtaaaaatgtttgagaggactgctaatctggtaaacaatcagataatt
aactatcgatgtgatccatctgaaaagtggttggttttgattggaattgctccgggttca
cctgagaggccacagcttgtcaaagggaatatgcagcttttctctgttgaacagcatcgt
agtcaagctcttgaagctcatgctgcatcattcgccacgtttaaagttccagggaatgat
caaccttgtacactcattggttttgccacaaagtcctttaatgctggacagattgtctca
aagctacatgtcattgaacttggatccaacccagggaaaccaggatttacaaagaaacag
gctgatcttttctttcctccagattttgctgatgattttccagttgcaatgcagatatcg
cacaaatatggcttgatatatgtgattaccaagcttggattgctgtttgtgtatgacctg
gagtcggcttctgcagtatacagaaacaggattagtccagatccaatatttttgactgct
gaagctacatctattggaggtttttatgccatcaataggcgagggcaggtgttacttgct
actgtaaatgaggcagcaattgtgcctttcgtcagtggccaattgaacaacttggagcta
gctgtcaatctcgcaaaaaggggaaatctccctggtgcagagaacttggttgtccagcgt
ttccaagaattgtttgctcagacaaagtataaggaggctgctgagcttgctgctgaatct
ccacaaggaattctccgtacaccggacacagttgccaaatttcagagtgttcctatgcaa
tctgggcagactccacctttgctacagtactttggaacacttctaactagaggaaagctc
aatgcatttgagtcattggaattatcacgcctggttgtgaatcagaacaagaagaatctt
ttggagaattggttagcagaggacaagctggagtgcagtgaggaacttggggatctagtg
aagactgtggatactgaccttgcactcaaaatatatattaaagcgagagcaactccgaaa
gttgttgcagcctttgctgagcgtcgggagtttgacaaaattctgatatactcaaagcag
gttgggtatactcctgattatttgttccttctgcaaaccattcttcgatcagatcctcag
ggagctgtaaattttgcgctaatgatgtctcaaatggagggaggttgtcccattgatttt
aatacgataactgatctctttcttcagaggaacttgatacgtgaagcaacagcatttttg
ttagatgttttgaagccaaatttacctgagcatggtttcctgcaaacaaaggtcctggaa
atcaatctggtaacttacccaaatgttgcagatgctatattagcaaatgggatgtttagc
cattatgatcgtccacggattgcccagctttgtgaaaaagctggtctttatgtgcgagcc
cttcagcattatactgagttgccagatataaaacgcgtcattgtgaatacacatgcaatt
gagccacaggcacttgtagagttctttggtacgctttcacgagaatgggctttggagtgc
atgaaggaccttcttctggtcaatctaagaggcaaccttcagataattgttcagactgcc
aaagaatattctgagcaattgggtgttgatcaatgcgtaaaactctttgagcaatttaaa
tcatacgaaggattgtacttttttctgggttcttatttgagctcaagtgaggatcctgac
attcacttcaagtatattgaagctgctgctaaaactggacaaattaaggaggttgagcgt
gtgactcgagaatcaaacttctatgatgctgaaaaaacaaagaacttcctaatggaagcc
aagcttccagatgcacggccgctgattaatgtgtgtgaccgttttggttttgtcccagat
ctcacacattacctatacacgaacaacatgcttcgatatattgaaggttatgttcaaaag
gtgaaccctagtaatgcacctttagttgtggggcagctgctagatgatgaatgtccagaa
gatttcattaaaggtctaattctttctgtccggtcgctgcttcctgttgagccccttgtg
gatgaatgtgagaagagaaatcgactccgtttactcactcagttcttggagcatcttgtg
agtgagggaagccaagatgtgcatgtccataatgctctgggtaaaatcattatagacagc
aacaataatccagagcacttcctcactaccaacccatactatgattctcgtgttgtgggt
aaatattgtgaaaagcgtgatcccaccctcgcagttgttgcttaccggagaggacaatgt
gacgaagaacttataaatgtcacaaataagaactctttgttcaaactgcaagccagatat
gtagttgaaaggatggattctgatctctgggagaaagttcttgaccctgataatgattat
agaagacagctcattgatcaagtagtatctactgctttgccagaaagcaagagtccagaa
caagtttctgcggctgttaaggctttcatgacagctgatctaccccacgagctaattgag
cttcttgaaaagattgtgcttcaaaactctgcattcagtgggaactttaatctgcagaac
cttcttatcttgacagccattaaagcagatccatctagagtgatggattacattaacagg
ctggataactttgatggtcctgccgttggtgaagttgcagtggaagcccaactgtttgaa
gaagcatttgcaattttcaagaagttcaacttgaatgtccaagctgtcaatgtgttactg
gataatatccaaagcattgagcgtgctgtggagtttgcattccgtgttgaagaagatgct
gtttggagccaggtggccaaggctcaactaagggaggggttggttagtgatgcaattgag
tcatttattcgtgcagatgatgccacccagttcctagatgttattcgtgctgctgaagat
gcaaatgtttaccatgacttagtgaggtaccttttgatggttagacagaaggcaaaagag
cccaaagtggacagtgagctcatttatgcttatgcgaagattgatcggctgggtgaaatt
gaagaattcattctcatgccaaatgttgctaatctccaaaatgttggtgatcggttgtat
gatgaagccctatacgaggctgcaaaaataatatttgcttttatttctaattgggccaag
ttggcctgcacacttgtgaagttgagacagttccaaggtgctgttgatgcagcacggaag
gctaacagctcaaagacatggaaggaggtttgctttgcttgtgttgatgcagaagagttc
cgcttagctcagatatgtggtctcaacattattatacaggtcgatgatttggaggaggtc
agtgattattaccagaatagaggatgcttcaatgagctaatatcactcatggagagtggt
ctgggcttggagcgtgcacatatgggcatttttactgagttgggtgtcctgtatgctcga
tatcgtcctgagaagcttatggaacacatcaaactgttttcaacccgtctcaacattccc
aagcttatacgggcttgtgatgaacagcagcactggaaggaactcacttacttgtatatc
caatatgatgagtttgacaatgctgcaaccactataatgaaccattctcctgatgcatgg
gaccacatgcagtttaaagatgttgcagtcaaagttgctaatgtggagctctattacaag
gccgtgcacttttacttgcaagagcatcctgatctcattaatgatcttctaaatgtgctt
gcacttcgagtagaccatactcgtgtggttgacataatgcggaaggcaggtcaccttcat
cttgtgaagccatatatggttgcagttcagagtaacaatgtttctgctgtgaatgaggct
ttgaatgggatttatgttgaggaggaagactatgacagactgcgtgaatcaattgatatg
catgataactttgatcagattggccttgcacagaagattgagaaacacgagcttcttgag
atgagacgtgttgctgcttatatttacaagaaagcaggcagatggaagcaatcaattgca
ttgtcgaagaaagacaacctgtacaaagacgcgatggagactgcctcgcaatctggtgac
cgtgaacttgcagaggagttgcttgtttatttcattgagaagggaaagaaagaatgcttt
gcatcttgcctctttgtgtgctacgacttaattcgtccagacattgctcttgaacttgcc
tggattaacaatatggttgactttgccttgccatatctgttgcagtttatccgcgagtac
gcaggcaaagttgatgaacttgttaaggacaagctggaagctcttaatgaagttaaggct
aaagagaaggaagagaaggatgtaatcgcccagcagaatatgtatgctcagttgctgccc
cttgctttgcctgcacctccgatgcccggcatgggaggagctgggatggcaggaggtttt
gttccacctcccatgggtagtatgggaatgcctccaatgcctccttttggaatgccgcca
atgggcacttattaa

DBGET integrated database retrieval system