KEGG   Vitis vinifera (wine grape): 100257371Help
Entry
100257371         CDS       T01084                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100257371
Enzymes [BR:vvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100257371
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100257371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 840 aa AA seqDB search
MYGSVGLFSTPLLGSSSTPSSRNHYKTGSGNKYCLAKQQPIRVSNGPRLQKLLGHCTFHC
PSRNSTYGKVNGSAISALITDDNSAMATMGEDTEHIGILDTDPGLEPFKDHFRYRMRRYV
EQKELIEKYEGSLEEFAQGYLKFGFNREEGGIVYREWAPAAQEAQVIGDFNGWDGSNHRM
ERNQFGVWSIKIPDSGGNPAIPHNSRVKFRFKHGDGVWVDRIPAWIRYATVDPTAFAAPY
DGVYWDPPPSERYQFKYPCPSKPNAPRIYEAHVGMSSSEPRVNSYREFADDILPRIRANN
YNTVQLMAVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLRVLMDVVHSH
ASNNVTDGLNGFDVGQSSQDSYFHTGDRGYHELWDSKLFNYANWEVLRFLISNLRWWLEE
FKFDGFRFDGVTSMLYHHHGVNMTFTGNYNEYFSEATDVDAVVYLMLANCLIHKIFPDAT
VSAEDVSGMPGLGRPVAEGGTGFDYRLAMAIPDKWIDYLKNKKDEEWSMKEISSSLTNRR
YAEKCISYAESHDQALVGDKTIAFLLMDKEMYSGMSCLTDASPTIDRGISLHKMIHFITM
ALGGEGFLNFMGNEFGHPEWIDFPREGNDWSYEKCRRQWELVDTDHLRYKYMNAFDTAMN
LLDEKFSFLASTKQIVSSTDEEHKVIVFERGDLVFVFNFHPENTYDGYKVGCDLPGKYRV
ALDSDACVFGGQGRVGHDADHFTSPEGIPGVPETNFNNRPNSFKVLSPARTCVVYYRVEE
SLEESDDDHNSTGANATLVADVVAEQESLEEPASVKDHEFKPRLIEGSEVEDVVEEATDD
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatcggtgggtcttttctcgacgcctcttcttggctcttcttcgacaccttcg
tcaagaaaccactacaaaacaggctcaggaaacaaatattgccttgctaaacagcaacca
attcgagtaagcaatggtcctaggttgcaaaaactccttggccattgcacattccattgc
ccatcaaggaactcaacatatgggaaggtgaatggttctgcaatctcagctctcattaca
gatgacaattcagccatggcgaccatgggagaagacactgaacatattggtatcttggac
acagatccaggactggaaccatttaaagatcacttcagatatagaatgaggagatatgta
gagcagaaagagcttattgaaaaatatgaaggaagtcttgaggaattcgcacaaggttat
ttgaaatttggatttaacagagaagaaggtggcattgtgtaccgtgagtgggcccctgct
gcacaggaagctcaagttattggggacttcaatggatgggatggttccaaccacagaatg
gaaaggaatcagttcggtgtttggagcatcaagattcccgactctgggggaaatccagcc
attcctcataactcacgagtaaagttccgattcaagcatggtgatggagtttgggttgat
cgaatccctgcttggatcagatatgccactgtggaccccacagcatttgcagcaccatat
gatggtgtgtattgggacccaccgccttcagaaagatatcagtttaagtacccttgtcct
tcaaaacccaatgccccacgaatatatgaggctcatgttggaatgagtagctccgaaccc
cgtgtgaattcatatagagagtttgctgatgatatcttacctcgtattcgggcaaataac
tataacacagttcaattgatggctgtgatggagcactcctattatgcatcatttgggtat
catgttactaacttttttgctgtcagcagtagatctggaactcctgaggacctcaaatat
ttgattgataaagcccatagcttaggtttaagagtcttgatggatgttgttcacagccat
gcgagtaacaatgtcactgatggcctcaatggctttgatgttggtcaaagctcacaggat
tcctacttccataccggagatcgaggctaccatgagttatgggatagcaaactctttaac
tatgccaattgggaagttcttcgcttcctaatatccaacttgagatggtggctagaggag
tttaaatttgatgggtttaggtttgatggagtaacttcaatgctgtatcatcaccatggt
gtcaacatgacatttacagggaattataacgagtatttcagtgaggcaacagatgttgat
gctgtagtttatttgatgctggccaattgtctgattcataaaatctttccagatgcaact
gtaagtgccgaagatgtttctggcatgcctggtcttggtaggccagttgccgaaggggga
actggttttgattaccgcctggcaatggccatacctgataagtggattgactacttgaag
aacaagaaagatgaagagtggtcaatgaaggaaatatcatcaagcttgacgaataggaga
tacgctgagaaatgtatatcgtacgccgaaagtcatgatcaggcccttgtgggagacaaa
actattgcatttcttctgatggataaagaaatgtatagtggcatgtcctgtttaacggat
gcttctcctactattgaccgagggatctcacttcacaagatgattcattttataacaatg
gcattgggaggtgagggctttcttaatttcatgggaaatgagtttggccatccggagtgg
attgacttcccaagagaaggcaatgattggagttatgaaaaatgccgacgccaatgggaa
ctggtggatacagatcacttgagatacaagtacatgaatgcatttgacacagctatgaat
ttgctggatgaaaaattttcattccttgcatcaacaaaacagatagtgagcagcacagat
gaagaacataaggttattgtctttgagcgtggagatcttgtttttgtgttcaactttcat
ccagagaatacatacgacgggtacaaagttgggtgcgacttgccagggaaatatagagtt
gcactggatagtgatgcttgtgtatttggtggacaaggaagagtgggccatgatgcagac
catttcacatcacctgaaggaataccaggagtccctgaaacaaatttcaacaaccgtccc
aattccttcaaagtactctcaccagctcgcacatgtgtggtttactacagagttgaagaa
agtctagaagaaagtgatgatgatcacaattctactggtgccaatgcaactttagtagcc
gacgtggttgctgagcaggagagtcttgaggaaccagcttctgttaaagaccatgagttc
aagccgagattgattgaaggttcagaagtagaagatgtggtggaagaggctacagatgac
tga

DBGET integrated database retrieval system