KEGG   Vitis vinifera (wine grape): 100257420Help
Entry
100257420         CDS       T01084                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 16
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100257420
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100257420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 1225 aa AA seqDB search
MLVPGDLGFSCLALLSLFFPVIGLVIRHKWRVAVARKEEIKRLLILASEEAARAELETAA
VSVSPQFQCAVCYCPTTTRCARCKAVRYCSGKCQIIHWRQGHKEECNPPSITHQIIDESI
SSSQKAVKQEKHAIYDNRLETEGQQCVKPIETFLSEPAFSKPNCSPEVSCEEDDHIKVEF
LADGNVSDSTSKSSSTSFSGFSTSTDRAEPSDNVSVSTTSSELSDDVSVSESINSYDPEK
SDGHKSDDSAMPETISSINTHQNEPFSPEFTGLVDSVNSFTGSSKLNQIKSSCSDVETQC
RSSSSGLSIKSCNERSVAQPSTASSGFWEGTLDLNRTRNHAQDDSAQSYASGADSNISDS
ESVLRFSFNLSGSTIPPLHAEVSESKSTVLDDAHPSTLGIKKPIEGVASSEKISTLGIKK
PIEGVASSEKISTKALKFRNSPSLAFESSNLVDSGPSNDSHKLKSREVKPFSSSVSNAHP
SCSTGGDSISIDAPKARSSSSLSSERSNHVVNGKSGASHQLKSREVESLSSGASDPHLSS
STEGHSVASMRSGKSTVDSDLHLSSSTRGHPVPNVKSGKVDGVHTVAASSSQIANHSPIV
SNGLKTSVRKVVDQFRPSKLSKSLPLGVGSEIAGRCSDKGLFSYEVFVKLYIWNKVELRP
CGLMNCGNSCYANAVLQCLAFTPPLTSYFLQGLHSKSCLKKEWCFTCEFESLILKAKEGN
SPLSPLGILSQIRNIGSHLGNGKEEDAHEFLRYAIDAMQSVCLKEAGVNASGSLEEETSL
IGLTFGGYLRSKIKCMKCHGKSERHERMMDLTVEIEGDIGTLEEALHKFTSTEILDGENK
YQCSRCKSYEKAKKKLTVSEAPNILTIALKRFQSGKFGKLNKSIRFPEILDLAPFMSGTS
DKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKNIQNKWFKIDDSTVKPVELERVLTKGAYM
LLYARCSPRAPRLIRNAVIPRNRKLEAASSRNIVKNTTFKLRHDSIDSTAGQSMIHSKPT
AYHSRSPVDCPASFESFYSEETRFPWKQRIVEADSSSDNSSLFTEEGSCSTESNRDSTST
EDLSDYIFGYSGRGWSSPWTNSSDSDTSSSSSSLRSSPLAELNRYSSCSTETSHSQTDKA
KLVMEGDGFWARPPNGSSKLVDMEGKGDIPFLLSDIAKPCRKLVSNSSSDSYCKETDKEK
VGRVNPLDSMKLGVPSRRSTRERTD
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcctggggatcttgggttttcgtgcctggccctgctgtcgttgtttttcccc
gtaatcggattggttatccggcacaaatggcgggtagccgttgcgaggaaggaggaaatc
aagaggcttttgattttggcttctgaggaggcagctagggcagagctcgaaaccgcggca
gtatcggtctcgccgcagttccagtgcgccgtctgttattgccccactacaacgcggtgc
gctcggtgcaaagccgttcgttattgttctggcaaatgtcaaattattcattggcgacaa
ggtcacaaagaagaatgcaatccacctagcatcactcaccagattatcgatgagagtatc
agttctagtcagaaggcggtaaagcaagaaaaacatgcaatttatgataacaggttggag
actgaagggcagcagtgtgtgaaaccaattgaaacattcctaagcgaacctgcattttct
aaacccaattgctctcctgaagtttcatgtgaagaggacgatcacattaaagttgagttc
cttgcagatgggaatgtatcagattccacttccaaatcttccagtacatccttttctgga
ttctctacgtccaccgacagagctgaaccatctgataatgtttctgtttccactaccagt
agtgaattatctgatgatgtttctgtcagtgaaagtattaattcatatgatcctgaaaaa
tcagatggacataaatctgatgattctgccatgcctgagacaatttctagtattaacaca
catcagaatgaaccattctccccagagttcactggtttggttgattctgtaaatagtttt
actggttctagtaaattaaatcagatcaaatccagctgtagtgatgttgagacacagtgc
agatcaagtagttctggtttgagcattaaaagctgcaatgaacgttcagttgcccagccg
tctacagcctcttctggattctgggaaggaactcttgatttgaataggaccagaaatcat
gcccaggatgattctgctcaatcctatgccagtggagctgatagcaatatatctgattct
gaatctgttttacgtttttctttcaacttgtctggaagtaccattcctcctttgcatgca
gaagtctccgagagtaaatccactgtgttagatgatgctcatccatctactctagggatc
aaaaagcctattgagggagttgcttcatcagaaaagatatctactctagggatcaaaaag
cctattgagggagttgcttcatcagaaaagataagtacaaaggccttaaagtttaggaac
tcaccatctttggcctttgaaagctctaatcttgtggatagtggccctagcaatgattca
cataaactgaagtccagagaagttaaacccttttcatctagtgtttctaatgctcatcca
tcttgtagtactggaggagattcaattagtattgatgctcctaaggccaggagctcttca
tccttgagctctgagaggtcaaaccatgttgttaatggcaaaagtggtgcctcacatcaa
ttgaaatctagagaagttgaatctttatcatctggtgcatctgatcctcatttatcttcc
agcactgaagggcattcagtcgcaagtatgagatctggaaagtcaacagttgattctgat
ttgcatttatcttctagcaccagaggccatccagttccaaatgtgaaatctggaaaggtt
gacggtgttcacacagtggctgctagctcctcccagattgctaatcattcgccaattgtt
agtaatggtctgaaaacatctgttcggaaagttgttgaccaattcagaccctctaaattg
tcaaaatcccttccattaggggttgggagtgagattgctggaagatgtagtgacaagggt
ctcttttcttacgaagtgtttgtcaagctttacatttggaacaaggttgagctgcgccca
tgtggcctcatgaattgtgggaacagctgttacgctaatgctgtgctccagtgcttggca
tttactccacctcttacttcttattttcttcaaggactccactccaaatcatgtttaaag
aaagaatggtgtttcacctgtgagtttgaaagtcttattttgaaggcaaaggaagggaat
tctccactttctcctcttggtatactgtcccaaataagaaatattggaagtcatcttggt
aatgggaaagaagaagatgcacatgaatttttaaggtatgctattgatgcaatgcaatct
gtttgtcttaaggaagctggggtgaatgcttcaggctctttggaagaggaaacatctctt
attggccttacctttggaggctaccttcgttcaaagataaaatgcatgaagtgccatggt
aaatctgagcggcatgagagaatgatggatcttactgttgagatagaaggagatataggt
actctggaagaggctcttcataaatttactagcaccgagattcttgatggggaaaacaag
taccaatgtagcagatgcaaatcttatgagaaagccaaaaagaagttgacagtatcagag
gctcctaatatccttacaattgcattaaagcgatttcagtcgggtaaatttggaaagctc
aataagtcgataagatttccagagatcttggacttggctccatttatgagcgggacaagt
gataaatcacctatatacaggctttatgcagtggtggtacacttggatatcatgaatgct
gcattttctggtcactatgtgtgttatgtgaaaaacatccagaacaaatggttcaagatt
gatgacagcacggtgaaacccgtggagcttgaaagagtcttaacaaaaggggcatacatg
cttctttatgcaaggtgctcaccacgggccccaagattgataagaaatgcagtaattcct
cgcaatagaaaattggaagctgcttcttccagaaacattgttaagaatactacattcaag
ttaaggcacgactccatagattcaactgctggccagtctatgatacattcaaagcccaca
gcctaccacagtagaagccctgtggactgccccgccagttttgaatcattttattcagaa
gaaacaaggtttccctggaagcaaaggattgtagaagctgactcatcaagtgacaattct
tctcttttcactgaagaaggttcgtgcagtacagagagcaaccgggattctacaagcacg
gaagacctttctgattacatatttggttattcaggacgtggttggagcagcccttggaca
aattcatctgactctgacacttcttcctcctcttcctctttaaggagttcaccccttgct
gagttgaaccgctactcttcatgttctaccgaaacaagtcattctcaaactgataaagca
aaattggttatggagggtgatgggttttgggcaaggccacccaacgggagtagcaagcta
gtggatatggagggtaagggagacattccttttttgctatctgacatcgctaaaccgtgt
agaaagttagttagtaatagtagtagtgatagttattgtaaggagactgacaaagagaaa
gtaggacgggttaaccctttggacagcatgaagttgggtgtaccttctaggagatcaacc
cgggaaagaacagattag

DBGET integrated database retrieval system