KEGG   Vitis vinifera (wine grape): 100258106Help
Entry
100258106         CDS       T01084                                 

Gene name
CHS3
Definition
chalcone synthase
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100258106 (CHS3)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100258106 (CHS3)
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100258106 (CHS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 389 aa AA seqDB search
MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC
DKSMIKKRYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP
KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELV
SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFW
IAHPGGPAILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKT
TGEGLEWGVLFGFGPGLTVETVVLHSVST
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgtcaacgaagttcgcaatgcccagcgcgccgaaggcccagccaccgtgatg
gccatcggcactgccactcccccaaattgtgtggatcaaagcacctatcctgactactac
tttcgcatcacaaatagcgaacacaagactgagctcaaagagaagttcaagcgaatgtgt
gacaagtctatgatcaagaaacgttacatgcacttgacagaggagatcctgaaagagaac
cccaatgtttgtgaatacatggcagcttccctggatgctaggcaggacatggtggtggtg
gaggtaccaaagctaggcaaagaggcagccgcaaaggccatcaaggagtggggtcagccc
aaatccaagatcactcacctagtcttctgcaccaccagcggtgttgacatgcccggtgct
gactaccaactcaccaagctgctaggcctccgcccatcggtgaagcgcttcatgatgtac
caacagggctgctttgctggtggcaccgttctgcgccttgccaaggaccttgccgagaac
aacaagggcgcccgtgtccttgttgtctgctctgagatcactgctgttactttcagggga
cctagtgacactcacttggacagccttgttgggcaggcactttttggcgatggggcggcc
gctgttatagttggttccgacccgatcccaggggtggagaagcccatgttcgaattggtt
tcagcagcccagacaatcctccccgacagcgatggcgccatcgatgggcatctccgggaa
gtggggctgaccttccacttacttaaggatgtgcccggcctcatttccaagaacattgaa
aaaagcctgaatgaggccttccagcctttgggcatcaaggactggaactccattttctgg
attgcacaccctggtgggcctgcaatcttggatcaagttgaggaaaaattagccctaaag
cccgagaagttacgctccacacgacacgtcttgagcgagtatggtaacatgtcaagtgct
tgcgtgttgtttattttggacgagatgaggaggaagtcggctgaggaagggctgaagacc
acgggtgaggggctggaatggggcgtgctcttcggtttcggaccagggctcactgttgag
accgtggtgctccacagtgtgtctacttga

DBGET integrated database retrieval system