KEGG   Vitis vinifera (wine grape): 100258589Help
Entry
100258589         CDS       T01084                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
Organism
vvi  Vitis vinifera (wine grape)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 955 aa AA seqDB search
MAEMSMCSSSSREQVSPEEERLAIRDFVISAEAHTKEGDTFYLITQRWWQQWLEYVNQDQ
ANNIDVSSLSEHCDSVSSSDVKRPSVIDNSDLIYDMTSEDSTMGIELHDTLVEGRDYILL
PQEVWNQLYAWYGGGPTLPRKVINSGLSQTGLSVEVYPLRLQLVVVPKGAHSTIRISKKE
TIGELHRRACEIFDLNMEQVCIWDYYGHRKHALMNDMDKTLDDANIQTDQDVLVEVHSNG
SSSAFGGCMSSVQENGSADKETMSVLVEPSKSSLSIAGGLSASKGVSRSCSSELSQSQNL
TSPVRELDSTYGVSGVSTRGATGGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHK
EINWQNPLGMVGELALAFGDLLRKLWAPGRTPVAPRPFKTKLARFAPQFSGYNQHDSQEL
LAFLLDGLHEDLNRVKHKPYIKSRDADGRPDEEVADEYWANHIARNDSIIVDVCQGQYKS
TLVCPVCNKISVTFDPFMYLSLPLQSTITRTMTVTVFTCDGSALPSACTVTVPKQGRCRD
LIQALSGACSVKHNEKLLLAEIRNHLIDRFLEDPLILLSTIKDDDHLAAYKIPKLSKSTI
FLQLIHRREEQEIGNAQKSFGWKPYGTPLVSPISCDDVITRGDIQSIVYTMLSPMLRTER
QGHTDISETSISVAASDPSCDITTSEAFTDSIESDLKDMDGNSYKTVTLSKLPLQLVDEN
NACIDLSVGEEKPIKLSSSSMSILVFVDWSHKFLEKYDTHYLENLPEVFKYGPVTKKART
EPLSLYTCLEAFLREEPLVPEDMWFCPQCKEQRQASKKLDLWRLPEVLVIHLKRFSYSRS
MKHKLETFVNFPIHDLDLTNYVAHKNNSRSQIYELYALTNHYGGMGSGHYTAHIKLLDEN
RWYNFDDSHISAINEEDVKSAAAYVLFYKRVKIDDASVSNGAQSCAGHENILPQN
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggcggagatgtcgatgtgcagcagcagcagcagagagcaggtgagtccggaggaagag
aggctcgcgattagggactttgtgatttctgctgaggctcacaccaaggagggcgatacc
ttttatttgatcactcaaagatggtggcaacaatggctggagtatgtaaaccaagaccag
gcaaataacatagacgtatcctctttgtcagagcattgtgattcagttagttctagtgat
gtgaagaggccttctgttattgataattctgatttgatatatgacatgacatctgaggac
tccacgatgggaattgagcttcacgatactctagttgagggccgtgattatatattgctt
ccacaagaagtttggaaccaactgtatgcttggtatggaggtggtccaactttgccaagg
aaagtaattaattcaggcctctctcagacagggctgtctgtagaggtatatcccttgcgt
cttcaactggttgtggtaccaaaaggcgcccactctactataagaataagcaaaaaggaa
accattggggaacttcacagaagagcatgtgagatttttgatcttaatatggagcaagta
tgcatttgggattattatggccatcgcaaacatgctttgatgaatgacatggataaaaca
cttgatgacgccaacatacagacggatcaggatgttttagtggaagtccatagcaatggc
agtagctctgcatttggtggttgcatgagttctgttcaggagaatggatctgcagacaag
gaaaccatgtctgttcttgtagaaccttccaagtcgagtttatcaattgctggaggattg
tctgcaagcaagggtgtctctagaagctgcagttcagagctctcacaaagtcagaacttg
acttccccagttagggagctggatagtacatatggggtcagtggcgtaagtactaggggg
gctactggtggtctaactgggttgctgaatctgggaaatacttgttttatgaatagtgca
atacagtgccttgttcatacaccagaatttgctagatattttcgtgaagattatcataaa
gagataaactggcagaatcctctggggatggttggtgagctagctctagcatttggcgat
ttacttcgaaaactgtgggcaccaggacgaacaccagttgctcctcggccattcaaaaca
aagcttgctcgctttgcaccacaattcagtggatataatcagcatgattcacaggagctc
ttagcatttttattggatggtcttcatgaagatctgaatcgtgtcaagcacaaaccttac
ataaagtctagagatgctgatgggaggcctgatgaagaagttgctgatgaatattgggca
aatcacattgctcgcaatgattctataatagttgatgtgtgccaaggccagtacaagtca
actctggtttgtcctgtgtgtaacaaaatctctgttacatttgatccattcatgtacctc
tccttgcctctccaatcgaccatcacccgtactatgacagtaacagtttttacttgtgat
ggaagtgcactgccatctgcttgcactgtgactgttccaaagcagggacgttgcagggac
ttgatccaagcactcagtggtgcttgttccgtgaagcacaatgagaagcttctgctggca
gagatacgaaatcatttgattgaccggtttttggaagatcctctgatattgttgtccacc
ataaaagatgatgatcaccttgctgcctacaaaattccaaaattgtcgaagagcactata
tttcttcagttgatacaccgtcgtgaagaacaggaaattggtaatgctcagaaatcattc
ggctggaaaccttatggaactcctcttgtctcgccaatttcctgtgatgatgttatcaca
agaggtgatattcagtcaatagtttacaccatgctctctcccatgctaagaactgagaga
caggggcatactgatatttctgaaactagtatctcagttgcagcatcagacccatcttgt
gacatcactaccagtgaggcatttacagactctattgaatcagatttgaaggatatggat
ggtaacagttacaaaacagtgacactgtcgaaactccctttgcagttggttgatgaaaat
aatgcatgcattgacctatcagttggagaagagaagcccattaaattgtcctcatcatca
atgtcaatcctagtttttgtggattggtcacacaagtttttagagaagtatgatactcat
taccttgagaacttgccagaagtgttcaaatatgggcctgttactaagaaagctcgtact
gaacctctctctttgtacacttgcttggaagcttttcttcgtgaggagccactcgtacct
gaagatatgtggttctgtccacaatgcaaagagcagcggcaagcaagtaagaagctagat
ctatggaggcttcctgaagttctagtcatccatctaaagaggttctcatacagccgatca
atgaaacataagttggaaacatttgtcaacttccccattcacgacttagacttgacaaat
tatgtagcccacaagaacaattccagaagtcagatctatgaactctatgccctaaccaac
cactatggcggcatgggaagtggacactacactgcacatataaagcttctagatgagaac
aggtggtacaactttgatgatagccacatatcagctataaatgaagaggatgtaaagtct
gctgctgcttatgtgcttttctacaagagggtgaaaatcgatgatgcttctgtaagcaat
ggagcacaatcctgtgcaggtcatgaaaatattctccctcagaattag

DBGET integrated database retrieval system