KEGG   Vitis vinifera (wine grape): 100258601Help
Entry
100258601         CDS       T01084                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100258601
  Replication and repair
   03420 Nucleotide excision repair
    100258601
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100258601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MPQVKIIAKNFMDMVASLPAMKLDALYHNTFICEAILRSLPPLAKKYILQMLYIDVPVTA
KAMEEWVLADGFSKHRVAIDRLIQLRVFTETSDRKKETSYRLNPTFQTNLQKHLIYGGVL
PREPMPSNITVRLPSLDDLEAYALGQWECFLLQLISSTQTVMKVFQRGLLTQREKEAPRL
TESGFQFLLMDTNAQLWYIMREYISNSEERGVDPADLISFLLELSFHVTGEAYNINTLTE
FQRNTIKDLVDLGLVKLQQGRKESWFIPTKLATNLSMSLSDTSSRKQGFVVVETNFRLYA
YSSSKLHCEILRLFSRSFHFLISEFTNMSQIRLWETDLNRVETMPSHLYDEFPSRDVFEA
ACDFAREYGGLLWEDSKKMRLVVKAEIHLHMREYLRRPK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtgaaaataatcgccaagaattttatggacatggtggcatctttgcctgcc
atgaagctcgacgccctctaccacaatactttcatttgcgaagccattctcaggtctttg
ccacctctagccaagaagtatatattacaaatgttatacattgatgttccggtaacagcc
aaggcaatggaggagtgggtgctggcagatgggttttctaagcatagagtagccattgat
cgattgatccagttaagagtatttactgaaacttcggacaggaaaaaggaaacctcttat
agattaaatccaacgtttcagacaaatcttcaaaagcatttgatatatggcggggtttta
ccaagggaaccaatgccttcaaatatcactgtgaggctcccaagcttggatgatctagaa
gcctatgcccttggacaatgggagtgtttcttgctgcaacttataagctccactcaaact
gtgatgaaagttttccagcgtggtcttctgactcaaagagaaaaagaagctccacggtta
actgagagtggtttccagttcttgcttatggatacaaatgcacaactttggtacatcatg
agggaatatatctctaattctgaggagcggggtgtggacccagcagatttgatttcattt
ctgctagagctcagttttcatgttacaggagaggcatataatataaacacattgactgag
ttccagagaaatacaatcaaggacctggtagacttgggattggtcaaacttcagcagggc
agaaaagagagttggtttattcctactaaattagctaccaatctgtcaatgagcttatca
gatacatcatcgcggaaacagggatttgtggttgtggaaacaaactttaggttgtatgct
tattcatcatctaagttgcattgtgagattttacggctgttctcaaggagtttccatttt
ctaatatcagaattcactaatatgtcacagattaggctgtgggagacagatctgaacagg
gttgagacgatgccttcacatctttatgatgaattcccttctagggatgtctttgaggca
gcttgtgattttgcgagggaatacggtgggctgttatgggaggattcaaaaaagatgcgt
ctggtagtgaaggcagagatacatttgcatatgcgtgagtatcttcgccgcccaaagtag

DBGET integrated database retrieval system