KEGG   Vitis vinifera (wine grape): 100258601Help
Entry
100258601         CDS       T01084                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:vvi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:vvi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 238 aa AA seqDB search
MPQVKIIAKNFMDMVASLPAMKLDALYHNTFICEAILRYLDLLNLVQERGVDPADLISFL
LELSFHVTGEAYNINTLTEFQRNTIKDLVDLGLVKLQQGRKESWFIPTKLATNLSMSLSD
TSSRKQGFVVVETNFRLYAYSSSKLHCEILRLFSRSSVSTVATPCHGYLIRLWETDLNRV
ETMPSHLYDEFPSRDVFEAACDFAREYGGLLWEDSKKMRLVVKAEIHLHMREYLRRPK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtgaaaataatcgccaagaattttatggacatggtggcatctttgcctgcc
atgaagctcgacgccctctaccacaatactttcatttgcgaagccattctcagatatctg
gaccttctgaatttggtgcaggagcggggtgtggacccagcagatttgatttcatttctg
ctagagctcagttttcatgttacaggagaggcatataatataaacacattgactgagttc
cagagaaatacaatcaaggacctggtagacttgggattggtcaaacttcagcagggcaga
aaagagagttggtttattcctactaaattagctaccaatctgtcaatgagcttatcagat
acatcatcgcggaaacagggatttgtggttgtggaaacaaactttaggttgtatgcttat
tcatcatctaagttgcattgtgagattttacggctgttctcaaggagttctgtatctact
gttgccactccttgccatggttaccttattaggctgtgggagacagatctgaacagggtt
gagacgatgccttcacatctttatgatgaattcccttctagggatgtctttgaggcagct
tgtgattttgcgagggaatacggtgggctgttatgggaggattcaaaaaagatgcgtctg
gtagtgaaggcagagatacatttgcatatgcgtgagtatcttcgccgcccaaagtag

DBGET integrated database retrieval system