KEGG   Vitis vinifera (wine grape): 100258649Help
Entry
100258649         CDS       T01084                                 

Definition
serine/threonine-protein phosphatase PP1-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100258649
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100258649
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100258649
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100258649
Spliceosome [BR:vvi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100258649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 393 aa AA seqDB search
MEKIMSRDNGENRLSHFFLSLSPLSPVLHFFYSFEREVDFGGVGGGGGGDREMDPSVLDD
IINRLREVRLRPGKQVQLSESEIRQLCVVSREIFLKQPNLLELCAPIKICGDIHGQYSDL
LRLFDYGGFPPQANYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINR
IYGFYDECKRRFNVRLWKIFTDCFNCLPVAARIDDKILCMHGGLSPDLHNLDQIRNLQRP
TDVPDTGLLCDLLWSDPSNDIQGWGMNDRGVSYTFGPDKVTEFLEKHDLDLVCRAHQVVE
DGYEFFANRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPAVKKLKFSFGSTTT
TKPGNSPEVFGSTTTTKPGNTPTGVKSFLGAKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagaagataatgagcagagacaatggtgaaaacaggctttctcacttctttctctct
ctgtctcctctctctcccgtactccatttcttttacagcttcgagagagaggttgacttt
ggtggcgttggcggcggcggtggtggtgatcgtgaaatggacccttcagttctcgacgac
ataatcaatcggcttcgcgaagttcgtcttcgacccgggaagcaggtgcagttatcggag
tcagagatccggcaactctgtgtagtttctagggagattttcttaaaacagcccaatttg
ttggagctatgtgcacccatcaagatttgcggtgatatacatggtcaatattcggatctt
ttaaggcttttcgactatggtggattccctcctcaagccaattacttatttttgggggat
tacgtagatcgcggcaagcaaagcctagagactatatgtcttctccttgcatataaaata
agatatcctgaaaacttcttcctcttgagaggaaaccatgaatgtgcatctataaaccgt
atatacggattttatgatgagtgtaagagaagatttaatgtcaggttgtggaagatcttc
actgattgttttaattgtctgccagtggcagcccggattgatgataaaattctctgcatg
catgggggactttcccctgatttgcataatttggatcagattagaaatttacaacgccca
actgatgtaccagacacaggattgctctgtgatcttctctggtcagatcccagtaacgat
attcaaggttggggaatgaatgacaggggagtttcttatacattcggccctgacaaagtg
acagagtttcttgagaagcatgatctggaccttgtttgtcgtgctcatcaggttgtagag
gatggttatgaattctttgcaaaccggcaacttgtaaccatattttcggcgcctaattat
tgtggggagtttgataatgctggtgccatgatgagtgtggacgacactctaatgtgctct
ttccaaatattaaaacctgcagttaagaagttaaagttcagctttggaagcactactacc
actaagcctggaaattctccagaagtctttgggagcacaactacaactaagccaggaaac
actccaactggagtcaagtccttcctcggtgcaaaagtatga

DBGET integrated database retrieval system