KEGG   Vitis vinifera (wine grape): 100258699Help
Entry
100258699         CDS       T01084                                 

Definition
mitogen-activated protein kinase kinase 5-like
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100258699
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100258699
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100258699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 355 aa AA seqDB search
MKPNQPPTAAASSSAANTRIRPRRRPDLTLPLPQRDPSLAVPLPLPPTSAQSSSSGGAAA
AATPAFSELERINRIGSGSGGTVYKVLHRPTGRLYALKVIYGNHDDDVLRQICREIEILR
DVDNPNVVKCHDMYDHAGEIQVLLEHMDGGSLEGTHIADELALSDLAFQILSGLHYLHRR
KIVHRDIKPSNLLINARRQVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNHG
RYDGYAGDIWSLGVSILEFYLGRFPFAVGRQGDWASLMCAICMSQPPEAPVTASREFRDF
ISRCLQRDPAVRWSADKLLRHPFVLQSQRRRGQSQSQVHHPPQLLPPPRLHSSTS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaatcaaccccctaccgccgccgcctcctcctcagccgccaatacccggatt
cggcctcgacggcggcccgacctcacgcttcctctcccgcagcgggatccttcccttgcc
gtgccgcttcctcttccgccgacgtcggctcagtcttcgtcctccggaggggcggcggcg
gcggcgacgccagcgttctcggagctggagagaatcaacagaatcggaagcggtagcggc
ggcaccgtgtacaaggtcctccacaggccgacggggaggttgtacgccttgaaggtgatc
tacggaaaccacgacgacgacgtgctccgccagatctgtcgagaaatcgagatcctcaga
gatgtggataaccccaacgtggtgaagtgccacgacatgtacgaccacgccggcgaaatc
caggtgttgctggagcacatggacggtggatctcttgaggggactcacatcgcggacgag
ctcgctctctccgatctcgcgtttcagatcctctccggcctccactacctccatcgccgg
aaaatcgtgcaccgcgacatcaaaccttcgaacctcctaatcaacgccaggcgacaagtg
aagatcgccgacttcggtgtgagccggatcttggctcagaccatggatccgtgtaactca
tcggtgggaacgatcgcgtacatgagtccggagcggatcaacaccgatctcaaccacggc
agatacgacggctacgctggcgacatctggagcctcggtgtgagcatcttggagttttat
ttagggcgtttcccgtttgctgtcggccggcaaggggattgggcgagtttgatgtgcgca
atctgtatgtcgcagccgccggaggcgccagtcactgcatcaagggagtttagggacttc
atatcacggtgtctgcagagggatccggcggtccggtggtcggcagacaaacttctccgg
cacccctttgtgcttcagagtcagagaagaagaggacagagtcaaagccaggttcatcat
cctccccagcttcttcctcctccacgcctgcattcctcgacgtcttga

DBGET integrated database retrieval system