KEGG   Vitis vinifera (wine grape): 100258932Help
Entry
100258932         CDS       T01084                                 

Definition
probable pectinesterase/pectinesterase inhibitor 7-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100258932
   00500 Starch and sucrose metabolism
    100258932
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100258932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 556 aa AA seqDB search
MTMSSSKLSLSLVAFSAIVIFLALFSSTSLADDSICQSTPDPSSCKGLVQSNKSANVYDY
GRSSLKKSIATSRKFLSLVDKYLSARSNLSAAAVRALQDCRFLGGLNLDYLLSSSQVADA
NSKILSVLEADDVQTLLSALLTNQQTCLDGLQETSSSWSVKNGVSTPLSNDTKLYRVSLS
LFTKGWVPKQKKGKVVKARKHLPFGNGRLPLKMSSQNRKLYESLSNRKLLDTGNDQVSIS
DIVTVNQDGSGNFATINDAIAVAPNNTDGSNGYFVIYIQAGVYEEYVSIAKNKKYLMMIG
DGINQTVITGNRSVVDGWTTFNSATFAVVAQGFVAVNITFRNTAGAAKHQAVALRSGADL
STFYLCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYPRLPLSGQFN
AITAQGRTDPNQNTGTSIHNCVIRAADDLAASNGTTKTYLGRPWKEYSRTVYMQSNMGSL
INPSGWSIWSGDFALSTLYYAEYNNTGPGSNTSNRVTWSGYHVIGPSDAANFTVGNFLLG
GDWLPQTGVPYTGGLL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtcttcttctaagctttcgttgtccctcgttgctttctcagccattgtcatt
ttccttgctcttttctcatcgacatctctagcagatgactccatatgtcagtccacacct
gacccttcctcttgcaaaggccttgtccagagcaacaaatccgcaaatgtttacgattat
ggaaggtcatctttgaagaagtcgatagcgacttcgcgtaagttcttgtccctggttgac
aagtacctcagtgcccggtccaatttgtcggccgctgcggttcgggcgctgcaggactgt
cgctttctaggaggactaaacttggattacttgttgagctcttctcaagttgcggatgct
aattctaaaatcctgtctgttctggaagctgatgatgtgcaaaccttgcttagtgccctt
ttaactaaccagcaaacatgcttggatggtctgcaagagacctcttcttcatggagtgtg
aagaacggtgtttcaactcccctgtccaatgacactaagctctatagagtttctctatcc
ctcttcaccaagggttgggttcccaagcagaagaaggggaaagtggtgaaagctaggaag
catctcccctttggaaatgggcgcttgcccttgaaaatgtctagccaaaaccgaaaactc
tacgagtctttgagtaacaggaagttgctggacaccggtaatgatcaggtttcgataagc
gacatcgtgacggtgaaccaggatgggagtggaaatttcgcgaccattaatgatgccata
gctgtagctccaaacaataccgatggcagcaatggatactttgtgatttacatccaggcc
ggagtctacgaagagtacgtatccatcgctaagaataagaagtacttgatgatgatcggt
gatggcatcaaccagactgtgatcaccggaaacagaagcgtggttgatggatggacaact
ttcaactccgccacatttgctgtggtggcacaaggatttgttgcagtgaacataacattc
cggaacacagctggggcagcaaaacatcaagcggttgccctccggagcggggctgattta
tcaacattctacctgtgcagctttgaagcctatcaagacaccttatacacccattcccta
aggcaattctacagagaatgcgacatatatggaacggttgatttcatatttggcaatgct
gcagttgtcttccaaaactgcaacttatatccccggctgcccctgagcggacagttcaat
gccatcaccgcccaaggccggacggaccccaatcagaacaccggcacctcaattcacaac
tgtgtcattcgtgccgccgatgatttggctgcaagcaatggaaccacaaagacatacttg
ggaaggccatggaaggagtattcaaggacagtgtacatgcaatcaaacatgggtagtttg
attaatccttctggttggagcatttggtctggggattttgctttaagtacattatactat
gctgagtacaacaacaccggacccggatcaaacaccagtaatagagttacatggtctgga
taccatgtgattggaccttctgatgctgcaaatttcactgtcggcaacttccttctcggg
ggtgactggttgcctcagactggggtgccttacactggtggcttgttataa

DBGET integrated database retrieval system