KEGG   Vitis vinifera (wine grape): 100258939Help
Entry
100258939         CDS       T01084                                 

Definition
(RefSeq) eukaryotic translation initiation factor NCBP
  KO
K03259  
translation initiation factor 4E
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100258939
Messenger RNA biogenesis [BR:vvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100258939
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100258939
Translation factors [BR:vvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100258939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 225 aa AA seqDB search
MEITEKKEAESKGLNPQSVTEATSFNSDKEAEDRERQARDLKAGLHPLKHKFVFWYTRRT
PGVRTQTSYEDNIKKIVDFSTVEGFWICYCHLARPSALPSPTDLHLFKEGIRPLWEDSAN
CNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVWNRNASD
HQAVMALRDAIKRHLKLPHGYVMEYKAHDASLRDNSSYRNTWLRG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggagattacagagaagaaggaagcagagagcaagggcttgaacccccaatccgtgact
gaagcgacctcattcaatagtgacaaagaagccgaagatcgggaacgccaggctcgtgat
ctcaaagctggtcttcatcctctgaagcacaagtttgtattttggtacactcgtcgaaca
cctggagttcgaacccaaacatcatacgaggacaatataaagaaaattgtggatttcagt
acagttgaaggtttttggatttgctattgccatttggcccgtccatctgctttgcctagc
ccaactgatttgcatcttttcaaagagggaattcgccccctatgggaggattctgctaat
tgcaatggtggtaagtggataattagattcaaaaaagtcgtgtcaggtcgcttctgggaa
gatctggttcttgccttagtgggtgaccaacttgattatggtgataacatatgtggtgct
gtactaagcattcgtttcaatgaagatatattgagtgtgtggaatcgcaatgcatccgat
catcaggctgtaatggctctaagagatgcaatcaaacggcacttgaagcttccccatggc
tatgttatggaatacaaggctcatgatgcttctctccgtgacaactcatcttataggaac
acatggttgagaggatga

DBGET integrated database retrieval system