KEGG   Vitis vinifera (wine grape): 100258939Help
Entry
100258939         CDS       T01084                                 

Definition
eukaryotic translation initiation factor 4E type 3-like
Orthology
K03259  
translation initiation factor 4E
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100258939
Translation factors [BR:vvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100258939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 225 aa AA seqDB search
MEITEKKEAESKGLNPQSVTEATSFNSDKEAEDRERQARDLKAGLHPLKHKFVFWYTRRT
PGVRTQTSYEDNIKKIVDFSTVEGFWICYCHLARPSALPSPTDLHLFKEGIRPLWEDSAN
CNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVWNRNASD
HQAVMALRDAIKRHLKLPHGYVMEYKAHDASLRDNSSYRNTWLRG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggagattacagagaagaaggaagcagagagcaagggcttgaacccccaatccgtgact
gaagcgacctcattcaatagtgacaaagaagccgaagatcgggaacgccaggctcgtgat
ctcaaagctggtcttcatcctctgaagcacaagtttgtattttggtacactcgtcgaaca
cctggagttcgaacccaaacatcatacgaggacaatataaagaaaattgtggatttcagt
acagttgaaggtttttggatttgctattgccatttggcccgtccatctgctttgcctagc
ccaactgatttgcatcttttcaaagagggaattcgccccctatgggaggattctgctaat
tgcaatggtggtaagtggataattagattcaaaaaagtcgtgtcaggtcgcttctgggaa
gatctggttcttgccttagtgggtgaccaacttgattatggtgataacatatgtggtgct
gtactaagcattcgtttcaatgaagatatattgagtgtgtggaatcgcaatgcatccgat
catcaggctgtaatggctctaagagatgcaatcaaacggcacttgaagcttccccatggc
tatgttatggaatacaaggctcatgatgcttctctccgtgacaactcatcttataggaac
acatggttgagaggatga

DBGET integrated database retrieval system