KEGG   Vitis vinifera (wine grape): 100258964Help
Entry
100258964         CDS       T01084                                 

Gene name
CHLH
Definition
magnesium chelatase H subunit
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100258964 (CHLH)
Enzymes [BR:vvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100258964 (CHLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1381 aa AA seqDB search
MASLVSSPFTLPTSKVDQLSSFSQKHYFLHSFLPKKTNQANSKSCLRVKCAAIGSGLFTQ
TTPEVRRIVPDNDHGLPTVKVVYVVLEAQYQSALTAAVQTLNSKARYASFQVVGYLVEEL
RDEATYKTFCKGLEDANIFIGSLIFVEELALKVKAAVEKERDRLDAVLVFPSMPEVMRLN
KLGSFSMSQLGQSKSPFFQLFKKKKSSAGFADSMLKLVRTLPKVLKYLPSDKAQDARLYI
LSLQFWLGGSPDNLMNFLKMISGSYVPALKRTKIEYSDPVLFLDSGIWHPLAPCMYDDVK
EYLNWYGTRRDANEKLKGPNAPVIGLVLQRSHIVTGDESHYVAVIMELEARGAKVIPIFA
GGLDFSGPVERFLIDPVTKRPFVNSVVSLTGFALVGGPARQDHPRAVEALMKLDVPYIVA
LPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHALHKRVEQ
LCIRAIRWAELKRKSKAEKKLAITVFSFPPDKGNVGTAAYLNVFDSIFSVLKELKRDGYN
VEGLPETSESLIEDVLHDKEAKFSSPNLNIAYKMGVREYQTLTPYATALEESWGKPPGNL
NSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYSFVEKIFKAD
AVLHFGTHGSLEFMPGKQVGMSDVCYPDSLIGNIPNVYYYAANNPSEATIAKRRSYANTI
SYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIISTAKQCNLDKDVSLPDE
GEEISAKERDLVVGKVYSKIMEIESRLLPCGLHVIGEPPSAMEAVATLVNIAALNRPEEG
ISSLPAILAETVGRNIEDVYRGSDKGILKDVELLRQITDTSRGAISAFVERTTNKKGQVV
DVADKLTSVFGFGLNEPWVQYLSSTKFYQADREKLRTLFAFLGECLKLVVADNELRSLKQ
ALEGKYVEPGPGGDPIRNPKVLPTGKNIHALDPQSIPTAAALQSAMVVVDRLLERQKADN
GGKYPETVALVLWGTDNIKTYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEELGRPRI
DVVVNCSGVFRDLFINQMNLLDRAVKMVAELDEPADQNYVRKHALEQAQALGIEVRDAAT
RVFSNASGSYSSNINLAVENSSWNDEKQLQDMYLSRKSLAFDCDAPGAGMTEKRKVFEMA
LSTADATFQNLDSSEISLTDVSHYFDSDPTNLVQGLRKDGKKPNAYIADTTTANAQVRTL
SETVRLDARTKLLNPKWYEGMMSSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANST
FIQDEEMLKRLMNTNPNSFRKLVQTFLEANGRGYWETSEDNIEKLRQLYSEVEDKIEGID
R
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttggtgtcttccccattcactttacccacctccaaggtggaccaactctct
tcattctcccaaaagcattactttcttcattcttttcttcccaagaaaaccaaccaagcc
aactccaagtcctgcctgagagtgaaatgtgccgcaattggcagtggccttttcacccaa
accacccccgaagtccgtagaattgttcccgacaacgatcatggcctccccacagtcaaa
gttgtgtatgttgtgttggaagctcaataccagtcagcccttacggccgctgtccagact
ctcaacagcaaagccaggtatgcttcatttcaagttgtgggttacttggttgaggagctt
cgggatgaagctacttacaagactttctgtaaaggtcttgaggacgcaaatatatttatt
gggtctttgatttttgtggaagagttggccttgaaggttaaggctgcagtagagaaggag
agggacaggttggatgcagtcttggtgttcccttcaatgcctgaagtaatgagactaaac
aagttgggttcttttagtatgtctcagcttgggcaatcgaagagtcccttttttcagctc
ttcaagaagaagaagtcctccgctgggtttgcagacagtatgttgaagctcgtgaggaca
ttgccgaaggttttgaagtacttgcctagtgataaggctcaagatgctaggctttatata
ctgagtttgcagttttggcttggtgggtcccctgataatttgatgaatttcttgaaaatg
atttctgggtcttatgttccagccctgaagaggactaaaatcgagtattcagatccggtt
ctgttcttggatagcggtatttggcatcctttggctccttgtatgtatgatgacgtgaag
gagtatttgaattggtatggaactaggagggatgctaatgagaagcttaaaggcccaaat
gcgcctgtaattgggctagttctgcagagaagtcatattgttactggggatgagagtcac
tatgtggctgtgattatggagctggaggcaagaggggctaaagtgataccgatattcgcg
ggagggctggatttttcaggcccagttgagagatttttgatcgatccggttactaagagg
ccattcgtgaattcagtggtctccctgactggttttgctcttgttggggggccagcgagg
caggaccatccaagggctgttgaggcattgatgaaacttgatgttccttacattgttgca
ttgcctttggtgtttcaaacaactgaggagtggctgaatagtactctggggcttcaccca
attcaggttgccctgcaggttgctcttccagagctggatggaggcatggagcccattgtt
tttgctggccgggatcctagaacagggaaatcgcatgctctacacaagagggttgagcaa
ctctgcatcagagcgatcagatgggctgaacttaaaaggaaatcaaaggcagagaagaag
cttgcaatcactgtcttcagtttccctccagacaaaggaaatgttggaacagctgcatac
cttaacgtattcgactccattttctctgtcttaaaagaactcaaaagggatggttacaat
gttgagggcctgccggagacctctgaatccctgattgaagatgtgcttcatgacaaagaa
gctaaattcagcagcccaaatctcaatattgcttacaaaatgggtgtccgggagtatcaa
acccttactccctatgctacagcattggaagagagctggggaaagcctccaggcaatcta
aattctgatggggagaatctcttggtctatggaaaacagtatggaaatgtcttcattggg
gttcaacctacgtttggctacgagggtgatcctatgcggctccttttctccaaatctgct
agcccacatcatgggtttgcagcttactattcttttgttgagaaaattttcaaggccgat
gctgttcttcactttggcactcacgggtcacttgaattcatgcctggaaaacaggttgga
atgagtgatgtttgctaccctgatagtcttattgggaatattcccaatgtttattactat
gcagctaataatccatctgaagccaccatcgccaagcgccggagctatgcaaataccatt
agctatttgactcctcccgcagaaaacgctggactttacaagggactcaagcaacttagt
gagcttatctcctcgtatcaatctctcaaagacacgggtcgtggcccgcagattgtgagc
tccattattagcacagctaaacaatgcaatcttgacaaggatgtgagccttcctgatgaa
ggggaagaaatctctgcaaaagaacgagaccttgtggttggaaaggtgtattctaaaatt
atggaaattgagtcccgacttttgccttgtgggctacatgtcattggcgagcctccatct
gcaatggaagctgttgcaacactggttaacattgctgcattgaaccgtcctgaagagggg
atttcatcactcccagctatattagctgagactgttggaagaaatattgaggatgtctat
agaggaagtgacaagggaatactgaaggatgttgagcttcttcgccaaattaccgacaca
tcacgtggagctatctctgcctttgtggagcgaacaactaataagaaaggtcaagttgtt
gatgtagctgataagctgacctcagtcttcgggtttggcttgaatgagccttgggttcaa
tacttgtcaagcacaaaattttaccaggcggacagggagaagcttagaacattgtttgca
ttcctaggagagtgtttgaagctggtcgtggcagataatgagctgagaagtttaaaacaa
gctttggagggaaaatatgtggagcctggtcctggtggtgatccaattagaaacccgaaa
gtgttgccaacaggaaagaatattcatgccctggatccacaatctatacccactgcagca
gcattgcagagcgcaatggttgtggtggataggttgcttgagaggcagaaggctgacaat
ggtggaaagtaccctgagacagttgcccttgtgttgtggggaacggataacattaagact
tatggggagtcactggctcaggtcctgtggatgatcggtgtgaggccagttgctgatacc
tttggccgtgtcaaccgggtggagccggttagtctcgaagagcttggaaggcctagaatc
gatgttgttgttaactgctcaggagtcttcagagacctcttcatcaaccagatgaacctc
cttgaccgggcagtgaagatggttgctgagctagacgagccagcagaccagaactatgtc
aggaagcatgcactagagcaagctcaagcccttggcattgaggttcgagacgctgcaacc
cgtgtcttctccaatgcatcaggctcatactcatccaatataaatcttgctgttgagaat
tcctcatggaatgatgagaagcagctgcaagacatgtacttgagccggaagtccctcgca
tttgactgtgacgcccctggtgcaggcatgactgagaagaggaaggtctttgagatggct
ctaagcacagctgatgccacattccaaaaccttgactcatcagaaatctcactcactgat
gtgagtcactacttcgactcagatcccactaatctagtgcagggcctaaggaaggacggc
aagaagcctaatgcatacattgctgacacaaccacagctaatgcccaggtgaggacactt
tctgagactgtccggcttgatgctcggaccaagctgttgaaccccaaatggtatgaagga
atgatgtcaagtgggtatgagggcgtccgggaaatcgaaaagaggctgacaaatacagtt
gggtggagtgcaacctcaggccaagttgacaattgggtctatgaagaagccaactcgact
ttcattcaagacgaggagatgctaaagagactcatgaacaccaatccgaattctttcagg
aagttggtgcagaccttcttggaggccaatggaagggggtactgggaaacatcagaagat
aatatcgaaaagttgaggcagttgtactcagaagttgaggacaagattgaaggaattgat
cggtaa

DBGET integrated database retrieval system