KEGG   Vitis vinifera (wine grape): 100259090Help
Entry
100259090         CDS       T01084                                 

Definition
(RefSeq) bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase
  KO
K13082  bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00941  Flavonoid biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Module
vvi_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100259090
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     100259090
    1.1.1.234  flavanone 4-reductase
     100259090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA Polysacc_synt_2 DUF1731 KR adh_short RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 100259090
NCBI-ProteinID: XP_010664947
Position
18
AA seq 402 aa AA seqDB search
MEGGRTDQNEGGGKGSVCVTGATGFIGSWLVMRLLQRGYYVHGTVRDPADHGKVKHLLEL
PKAGTHLSLWRADLKEEGSFDDAIQGCVGVFHVASPMDISVKDAENEMIKPTVNGMLDIM
RACTKAKSVKRLIYTSTTGTISTGPQPPPLEFDESFWTDIDYCKAQKMTAWMYYVAKTTA
EKVAWEFAKEKGLDLVTIHPPFVIGPFISPSLSVGAKISLALLTGDERSYVLLTRGQAVH
VEDLCNAHIYLFEHPEARGRYICSSHCFEITELARSLSNKYPEYNIPAKFEGMDQFPKPV
PLSSKKLLDLGYKFQYNSEEYDIGDVCAEAIESCREKGLLPLPADKXEATRPEVMDTVTL
FYHIPLNLTIVHCFVIMLTTKAVIYAVLLSFMLDFMAIEFDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggtcggactgatcagaacgagggaggtggaaagggcagcgtttgcgtgacg
ggggccacaggattcataggatcatggctggttatgaggcttctccaacgaggttactat
gttcatggaactgtgcgcgatcccgcggaccatggtaaggtgaagcatcttctggaattg
ccgaaagccggcacgcatctgagcttgtggagagcagatttgaaggaagagggaagtttt
gacgatgctattcagggatgtgttggagtcttccatgtcgcttcccctatggacatatcg
gttaaggacgccgagaatgaaatgataaaaccaacagtaaatggaatgttggacatcatg
agggcctgcactaaggccaagagcgttaagcggcttatctacacttcaaccaccggaacc
atttccactgggccacaaccgcctccgcttgagtttgatgagagcttctggactgatata
gactactgcaaggctcaaaagatgactgcatggatgtattacgttgctaaaacaacagcg
gagaaagttgcatgggaattcgccaaagagaaaggccttgatcttgtcaccattcatccg
cctttcgtgattggtccttttatttcaccttccttgtcagttggtgctaaaatttcactt
gccttgcttactggagatgaacgcagctatgtgctcttgactcgaggacaagctgtgcat
gtagaggacctgtgcaatgctcatatatacctgtttgagcatccagaggcaaggggacga
tacatttgctcctctcattgttttgagatcacagagcttgctaggtcattgagcaacaag
tatccagagtacaatatcccagccaaatttgagggtatggatcaattcccgaaacccgtt
ccgctctcttctaagaaactattggaccttggatacaaatttcagtacaattcggaggaa
tacgacattggggatgtgtgtgctgaagccattgaatcatgcagagagaaggggcttctg
ccacttccggctgacaagtaagaagcaacgagaccagaagtgatggatactgtcactctc
ttttatcatattcctttaaatttgacaattgtgcactgttttgtgataatgctgaccact
aaagctgtgatttatgcggttttgctctcatttatgttggatttcatggccattgaattt
gacgtgtga

DBGET integrated database retrieval system