KEGG   Vitis vinifera (wine grape): 100259138Help
Entry
100259138         CDS       T01084                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100259138
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100259138
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100259138
  Exosomal proteins of colorectal cancer cells
   100259138
  Exosomal proteins of bladder cancer cells
   100259138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 499 aa AA seqDB search
MATRVSICLFVLAFAFSILASSPVKISAAEDEAKEFVLTLTHSNFSDIVSKHDFIVVEFY
APWCGHCKKIAPEYEKAASILSSHDPPIILAKVDANDDANKELASEFEIRGFPTLKILRN
GGKSIEEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSLIVDNKIVIVGVFPKFSGEE
FENFTAVAEKFRSDYDFVHTSDAKFLPRGESSVTGPLVRLLKPFDELFVDFQDFHVDALE
KFVEESSVPIVTLFNKDPSNHPFVIKFFNGPNAKAMLFLDHSSELFDAFKSKYHEVAEQY
KGKGINFLLGDLEASQGAFQYFGLKDDQVPLIVIQTNDGQKYLKPNLEPDHIAPWVKEYQ
DGKVLPYKKSEPIPEVNNEPVKVVVADTLQEIVFNSGKNVLVEFYAPWCGHCKKLAPILD
EVAISFENDADVVIAKLDATANDIPNDTFDVKGYPTLYFKSASGNISQYEGDRSKEDIIE
FIKKNRDKAAQQEGSKDEL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgactagggtttcgatctgcttgtttgtattggcttttgccttctcaatcttagct
tcgtctccggtgaagatctcggctgcggaggatgaagctaaagagttcgtcctcactttg
acgcactctaacttctctgacattgtcagtaagcacgacttcatcgtcgttgagttctac
gctccatggtgcggccactgtaagaaaattgcacctgagtatgagaaggctgcttctata
ctgagtagtcatgaccctccaattattcttgccaaagttgatgccaatgatgatgcaaac
aaagagcttgcatcagaatttgagattaggggcttcccaactcttaagattttgagaaat
ggagggaaatctattgaagagtacaaaggtcctcgtgaggccgatggtattgttgagtat
ctgaagaaacaaagtggtcctgcttctgctgagataaaatctgctgaagatgctagcagt
cttatcgttgacaataaaattgtcattgttggagtgttcccaaagttttctggagaggaa
tttgagaacttcacggctgtagctgagaaatttcgctctgactatgattttgttcatact
tcggatgccaaattccttcctcgtggggaatcatcagtgactggccccttggttaggctg
ttgaagccatttgatgaactctttgttgatttccaggattttcatgttgatgctctggag
aagtttgttgaggaatccagtgtgcctattgtcacactctttaacaaggatcctagcaac
cacccttttgttatcaaattcttcaatggtcccaatgccaaggccatgctgtttctagac
cacagcagtgagctttttgacgcttttaagtcaaagtatcatgaagttgctgaacaatac
aaaggaaaaggcataaacttcctcctgggagatcttgaagctagtcaaggtgctttccag
tattttggacttaaggacgaccaggtgcctctcatcgttatacaaaccaatgatggacag
aaatatctgaaacctaatttggagcctgaccatattgcaccttgggtgaaggaataccag
gatggcaaagtgctaccatacaaaaaatccgaacctatccctgaagtcaacaatgaacct
gtgaaggtggtcgtagctgataccctccaggaaatagtttttaactctggaaaaaatgtt
ctggtggagttttatgctccttggtgtgggcattgcaaaaaattggctccaatcttggat
gaagttgctatctcctttgaaaatgatgctgatgtggtcattgcaaagctggatgcaact
gcaaatgatatcccaaatgacactttcgatgtgaaaggatacccaactctgtactttaag
tctgctagcggaaacatctcgcagtatgaaggggataggtcgaaggaagacatcattgag
ttcattaagaagaatcgggataaggctgctcagcaagaaggctcaaaagatgagctgtga

DBGET integrated database retrieval system