KEGG   Vitis vinifera (wine grape): 100259138Help
Entry
100259138         CDS       T01084                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100259138
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100259138
Chaperones and folding catalysts [BR:vvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100259138
Membrane trafficking [BR:vvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100259138
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100259138
  Exosomal proteins of colorectal cancer cells
   100259138
  Exosomal proteins of bladder cancer cells
   100259138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 OST3_OST6 AhpC-TSA Thioredoxin_7 Redoxin Glutaredoxin Calsequestrin NIBRIN_BRCT_II TraF
Motif
Other DBs
NCBI-GeneID: 100259138
NCBI-ProteinID: XP_002285864
UniProt: E0CR49
Position
18
AA seq 499 aa AA seqDB search
MATRVSICLFVLAFAFSILASSPVKISAAEDEAKEFVLTLTHSNFSDIVSKHDFIVVEFY
APWCGHCKKIAPEYEKAASILSSHDPPIILAKVDANDDANKELASEFEIRGFPTLKILRN
GGKSIEEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSLIVDNKIVIVGVFPKFSGEE
FENFTAVAEKFRSDYDFVHTSDAKFLPRGESSVTGPLVRLLKPFDELFVDFQDFHVDALE
KFVEESSVPIVTLFNKDPSNHPFVIKFFNGPNAKAMLFLDHSSELFDAFKSKYHEVAEQY
KGKGINFLLGDLEASQGAFQYFGLKDDQVPLIVIQTNDGQKYLKPNLEPDHIAPWVKEYQ
DGKVLPYKKSEPIPEVNNEPVKVVVADTLQEIVFNSGKNVLVEFYAPWCGHCKKLAPILD
EVAISFENDADVVIAKLDATANDIPNDTFDVKGYPTLYFKSASGNISQYEGDRSKEDIIE
FIKKNRDKAAQQEGSKDEL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgactagggtttcgatctgcttgtttgtattggcttttgccttctcaatcttagct
tcgtctccggtgaagatctcggctgcggaggatgaagctaaagagttcgtcctcactttg
acgcactctaacttctctgacattgtcagtaagcacgacttcatcgtcgttgagttctac
gctccatggtgcggccactgtaagaaaattgcacctgagtatgagaaggctgcttctata
ctgagtagtcatgaccctccaattattcttgccaaagttgatgccaatgatgatgcaaac
aaagagcttgcatcagaatttgagattaggggcttcccaactcttaagattttgagaaat
ggagggaaatctattgaagagtacaaaggtcctcgtgaggccgatggtattgttgagtat
ctgaagaaacaaagtggtcctgcttctgctgagataaaatctgctgaagatgctagcagt
cttatcgttgacaataaaattgtcattgttggagtgttcccaaagttttctggagaggaa
tttgagaacttcacggctgtagctgagaaatttcgctctgactatgattttgttcatact
tcggatgccaaattccttcctcgtggggaatcatcagtgactggccccttggttaggctg
ttgaagccatttgatgaactctttgttgatttccaggattttcatgttgatgctctggag
aagtttgttgaggaatccagtgtgcctattgtcacactctttaacaaggatcctagcaac
cacccttttgttatcaaattcttcaatggtcccaatgccaaggccatgctgtttctagac
cacagcagtgagctttttgacgcttttaagtcaaagtatcatgaagttgctgaacaatac
aaaggaaaaggcataaacttcctcctgggagatcttgaagctagtcaaggtgctttccag
tattttggacttaaggacgaccaggtgcctctcatcgttatacaaaccaatgatggacag
aaatatctgaaacctaatttggagcctgaccatattgcaccttgggtgaaggaataccag
gatggcaaagtgctaccatacaaaaaatccgaacctatccctgaagtcaacaatgaacct
gtgaaggtggtcgtagctgataccctccaggaaatagtttttaactctggaaaaaatgtt
ctggtggagttttatgctccttggtgtgggcattgcaaaaaattggctccaatcttggat
gaagttgctatctcctttgaaaatgatgctgatgtggtcattgcaaagctggatgcaact
gcaaatgatatcccaaatgacactttcgatgtgaaaggatacccaactctgtactttaag
tctgctagcggaaacatctcgcagtatgaaggggataggtcgaaggaagacatcattgag
ttcattaagaagaatcgggataaggctgctcagcaagaaggctcaaaagatgagctgtga

DBGET integrated database retrieval system