KEGG   Vitis vinifera (wine grape): 100259138Help
Entry
100259138         CDS       T01084                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:vvi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 499 aa AA seqDB search
MATRVSICLFVLAFAFSILASSPVKISAAEDEAKEFVLTLTHSNFSDIVSKHDFIVVEFY
APWCGHCKKIAPEYEKAASILSSHDPPIILAKVDANDDANKELASEFEIRGFPTLKILRN
GGKSIEEYKGPREADGIVEYLKKQSGPASAEIKSAEDASSLIVDNKIVIVGVFPKFSGEE
FENFTAVAEKFRSDYDFVHTSDAKFLPRGESSVTGPLVRLLKPFDELFVDFQDFHVDALE
KFVEESSVPIVTLFNKDPSNHPFVIKFFNGPNAKAMLFLDHSSELFDAFKSKYHEVAEQY
KGKGINFLLGDLEASQGAFQYFGLKDDQVPLIVIQTNDGQKYLKPNLEPDHIAPWVKEYQ
DGKVLPYKKSEPIPEVNNEPVKVVVADTLQEIVFNSGKNVLVEFYAPWCGHCKKLAPILD
EVAISFENDADVVIAKLDATANDIPNDTFDVKGYPTLYFKSASGNISQYEGDRSKEDIIE
FIKKNRDKAAQQEGSKDEL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgactagggtttcgatctgcttgtttgtattggcttttgccttctcaatcttagct
tcgtctccggtgaagatctcggctgcggaggatgaagctaaagagttcgtcctcactttg
acgcactctaacttctctgacattgtcagtaagcacgacttcatcgtcgttgagttctac
gctccatggtgcggccactgtaagaaaattgcacctgagtatgagaaggctgcttctata
ctgagtagtcatgaccctccaattattcttgccaaagttgatgccaatgatgatgcaaac
aaagagcttgcatcagaatttgagattaggggcttcccaactcttaagattttgagaaat
ggagggaaatctattgaagagtacaaaggtcctcgtgaggccgatggtattgttgagtat
ctgaagaaacaaagtggtcctgcttctgctgagataaaatctgctgaagatgctagcagt
cttatcgttgacaataaaattgtcattgttggagtgttcccaaagttttctggagaggaa
tttgagaacttcacggctgtagctgagaaatttcgctctgactatgattttgttcatact
tcggatgccaaattccttcctcgtggggaatcatcagtgactggccccttggttaggctg
ttgaagccatttgatgaactctttgttgatttccaggattttcatgttgatgctctggag
aagtttgttgaggaatccagtgtgcctattgtcacactctttaacaaggatcctagcaac
cacccttttgttatcaaattcttcaatggtcccaatgccaaggccatgctgtttctagac
cacagcagtgagctttttgacgcttttaagtcaaagtatcatgaagttgctgaacaatac
aaaggaaaaggcataaacttcctcctgggagatcttgaagctagtcaaggtgctttccag
tattttggacttaaggacgaccaggtgcctctcatcgttatacaaaccaatgatggacag
aaatatctgaaacctaatttggagcctgaccatattgcaccttgggtgaaggaataccag
gatggcaaagtgctaccatacaaaaaatccgaacctatccctgaagtcaacaatgaacct
gtgaaggtggtcgtagctgataccctccaggaaatagtttttaactctggaaaaaatgtt
ctggtggagttttatgctccttggtgtgggcattgcaaaaaattggctccaatcttggat
gaagttgctatctcctttgaaaatgatgctgatgtggtcattgcaaagctggatgcaact
gcaaatgatatcccaaatgacactttcgatgtgaaaggatacccaactctgtactttaag
tctgctagcggaaacatctcgcagtatgaaggggataggtcgaaggaagacatcattgag
ttcattaagaagaatcgggataaggctgctcagcaagaaggctcaaaagatgagctgtga

DBGET integrated database retrieval system