KEGG   Vitis vinifera (wine grape): 100259355Help
Entry
100259355         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 26-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100259355
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100259355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1094 aa AA seqDB search
MSRPSTRSSKNKRHRADDNAATTCQIYRKIHSTGEVTKDDANQLYMIWKPICQGCRVNTK
DNPNCFCGLIPPPNGSRKSGLWQKMSDVVLALGPDPFKDLRASSEYSPAGLTNLGATCYA
NSILQCLYMNKTFRRGLFSVEPGLLKQYPVLDQLARLFAQLHASKLAFIDSAPFIKTLEL
DNGVQQDSHEFLTLLLSLLERCLSHSQVSRARTIVQDLFRGSVSHVTTCSKCGKDSEASS
NMEDFYELELNVKGLKSLDESLNDYLSVEELHGDNQYFCESCGTRVDATRSIKLRTLPYV
LNFQLKRCVFLPKTTTKKKITSAFCFPGELDMRERLSEPSDLELIYDLSAVLIHKGTTVN
SGHYIAHIKDENTGQWWEFDDEHVSNLGHHPFGEGSSSSAAKPVQTEPSVHLSSTEPMNG
VINGNHINIGQLQSSECSIVSGSQTYSSGDAYMLMYNLRRTTKSGEVRQTVSGANHMEIE
GDIIYSDNDAALPAHLYEEIKELNASYLDACQQYKSKKERELDCITERRQEVRSVLSEGP
VLSLEDPYFWISTDWLRLWADNITPPVLDNTPIQCLHGKVPVSKVGSMKRLSSKAWNMLF
SKYGGGPALSNDDYCINCLVEGASTMVSADNYRDRRKVMKELADAVHSGKCLDGNLYYVS
KSWFQQWARRKIIDSPCDADAGPTASIRCPHGKLMPEQAPGAKRLLVPENLWLFFCESAN
TVKPDDTLGCSVFPSDVEPCATCSMELTEVASIEDTLREFKLKQRQNHEKIALGKGFALS
SHCKYYLLPSSWLSTWRSYINANGKNVSSSVQPEMLDSVIDMMKCGKHSRLLERPLELIC
KRGTIFQRFSATDGLTIITKDDWKFFCEEWGCTEEMGISAEIEFSNCVANNLAGSCEEMP
IIEEHMSPHDEVNEEIESRQPVIKTSPEVCEVCIGERESCELMQKLNYCNEDIRVCFVRG
KEAPKSILEASGTISEPDRRISKRSRKTNFGNSINLKVSGSTSIYQLKMMIWESFGVIKE
NQILHKGSTVIDGETSTLADMNIFPGDLLWVKDSEIHEYRDIADELSDHKMEVQQAEEGF
RGTLLTSNISSQVV
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaccgagtacgcgcagcagcaagaataaaagacatcgggcggacgacaatgct
gcaactacttgccaaatatacaggaaaattcattcgacgggggaggtgaccaaggacgat
gcgaatcagttgtatatgatttggaagcctatttgtcaaggttgtcgagtgaatacaaaa
gataaccccaactgtttttgtggtctcattccgcctcccaatggaagccgaaagtccggg
ttatggcagaaaatgtccgacgtggttctggcactcggtcctgatcctttcaaggatctc
cgagcttcgtcggagtattcccccgcgggcctcaccaaccttggcgccacttgctacgcc
aacagcattctccaatgcctgtacatgaacaagactttcagacgaggtcttttctctgtt
gaaccgggtcttttgaaacaatatccagttcttgatcaacttgccaggctttttgcacag
ctgcacgccagtaaactggcttttatagactctgctccctttattaaaacgctagagtta
gataatggcgttcaacaggatagccatgagtttcttaccttacttctttctttgcttgag
cgatgtctcagccattctcaagtttcaagagccagaaccattgttcaggaccttttccga
ggaagtgtgtcgcatgtcaccacgtgctcaaaatgcggaaaagattctgaagcttcctcg
aatatggaagatttttatgaactggagttgaatgtcaagggtttgaaaagtttagacgag
agtttaaatgattaccttagtgtggaagagcttcatggagataaccaatatttttgtgag
tcatgtggaacaagagttgacgccacccgtagcattaagttacgcacactgccttatgtc
cttaatttccagctcaagcgctgtgttttccttccaaagactacaacaaagaagaaaatc
acttctgcattctgttttcctggagaattggatatgagagagaggctatctgaaccttct
gatttggaactaatatatgacttgtcagctgtgctgattcacaaggggactactgtgaac
agtggccattacatagctcatattaaggatgagaatacagggcaatggtgggaatttgat
gatgagcatgtctcaaacctgggtcatcacccatttggagaggggtcttcaagttctgct
gctaaacctgttcaaactgagccatctgttcatctgtcttccactgaaccgatgaatggt
gtcataaatggaaatcatataaatattggtcagctacaatcttcagaatgtagtattgtt
agtggttcacagacatactcatctggtgatgcatacatgttgatgtataatcttaggcgt
accaccaagagtggtgaagttagacaaactgtatctggtgccaaccatatggaaatagaa
ggagatataatttattcagacaatgatgctgctcttccagctcatctttatgaagagata
aaagaactaaatgcctcgtatcttgatgcttgtcaacaatacaaatcaaagaaggaaaga
gagttggattgtatcacagaacggaggcaggaagtgcgatcggttctttctgaaggccct
gttctatcacttgaggatccatatttttggatttctacagactggcttcgcctgtgggct
gacaacatcactccacctgttcttgacaacacccctatccagtgcttgcatggaaaagtc
ccagtatcaaaagttggttccatgaagcgcttgtcatctaaagcttggaacatgttgttc
tctaagtatggagggggacctgcactgtcaaatgatgactactgcatcaattgccttgtg
gaaggggctagcactatggtttctgctgataactatagggatcggcgaaaagtaatgaaa
gaacttgctgatgcagtacactcagggaagtgtctagatggaaatttgtactatgtttca
aaatcatggttccaacagtgggcacgcagaaaaatcattgactcaccatgcgatgctgat
gcaggaccaacagcttcaattagatgccctcatgggaaacttatgcctgagcaagctcct
ggtgctaagcgtttgctggttcctgaaaatctctggctcttcttctgtgaaagtgctaac
acagtcaaacctgatgataccttgggctgttcagtttttccttcagatgtggaaccatgt
gctacatgcagtatggagcttacggaagtggcaagcatagaagatacactaagagaattc
aagctcaaacagcgtcagaatcatgaaaaaatagcattgggaaaaggttttgcactttct
tcacattgcaagtattatttgctgccctcttcatggctgtcaacatggagaagctacatc
aatgcaaatggaaagaatgtttcatcatcagtgcaacctgaaatgttagatagtgtcatt
gatatgatgaaatgtggaaaacattcaaggcttctggaaagacctcttgaactgatttgc
aaacgtggcacgattttccaaaggttttctgctacagatgggttaacaatcataactaag
gatgattggaaattcttctgtgaggagtggggctgtactgaagagatgggcatctccgct
gaaattgagttcagtaactgtgtggcaaataatttagctgggtcctgcgaagaaatgcca
attattgaggagcatatgagtcctcatgatgaagtgaatgaggaaattgagtctagacaa
cctgtgattaagacttctcctgaggtatgtgaggtttgcattggagaaagagaaagctgt
gagttaatgcaaaaacttaactattgcaacgaggatatacgtgtctgctttgtacgtggt
aaggaagctcctaaatcaattttagaagcatctgggaccatttctgagccagatcgccga
atctctaagcgctctcgaaagacaaattttggaaattcgataaatctgaaagtttctggg
tccacatcaatctaccagttaaaaatgatgatatgggaatcctttggggtaattaaggaa
aaccagatacttcacaagggttctacagtaattgatggtgaaacttccactcttgctgac
atgaatatatttcctggagatcttctttgggtgaaagattcagagatccatgagtatcgg
gatattgcagatgagctctctgaccataaaatggaggtgcaacaggctgaggaagggttc
cggggaacgcttttgacatcaaatatctcgtcccaggttgtctaa

DBGET integrated database retrieval system