KEGG   Vitis vinifera (wine grape): 100259462Help
Entry
100259462         CDS       T01084                                 

Definition
4-alpha-glucanotransferase, chloroplastic/amyloplastic
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100259462
Enzymes [BR:vvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100259462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 585 aa AA seqDB search
MAMSMSMAMLSSHSLKASPLQNLSSKLFNVSSAVFASSRIKFQAKAPMNFNCLLKNDAVY
EDLPAVGEDLPPDYEEWTPKKDPKDRRRAGILLHPTSFRGPHGIGDLGEETFCFLDWLHE
AGCSVWQVLPLVPPGRKGNEDGSPYAGQDANCGNTLLISLEELVKDGLLMKEELPKPVDA
DRVDFSTVADIKDPLIAKAAERLILSEGELKNHFEDFRRDPEISNWLEDSAYFAAIDETL
NTISWYDWPEPLKNRHLSALEEIYQSKRDFINIFIAQQFLFQRQWQKVRNYAQMKGIKIM
GDMPIYVGYHSADVWANKKHFLLNKSGFPLLVSGVPPDAFSETGQLWGSPLYDWKAMERD
RFSWWIRRIRRAQNIYDEFRIDHFRGFAGYWAVPSEAKFAMDGQWKMGPGKSLFDAIFRA
VGKINIVAEDLGVITEDVIQLRKYIRAPGMAVLQFGFGSDADNPHLPHNHEQNEVVYTGT
HDNDTTRGWWDILEQEEKSNVLKYVTVTGEDDISWALIQAALSSVAQTAIIPMQDVLGLG
NSARMNIPATQSGNWGWRLPSSMSFDDLESEAKKLRDLLSIYGRL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtcgatgtcgatggcgatgctgagttctcattcactcaaggcttctccgctt
caaaatctttcttcaaaactttttaacgtttcatctgcggtattcgcctcctctcgcatc
aaatttcaagccaaggctccgatgaatttcaattgcctgttgaaaaatgatgccgtttac
gaagatctacctgctgttggcgaagatctgcctccggattacgaagagtggacgccgaag
aaggatccgaaggaccggagaagagccggtattctgctacatccgacgtcgtttcgaggc
ccgcacggcattggagatctcggcgaggagacgttttgcttcttggactggcttcacgag
gccggttgctccgtttggcaggttcttcctcttgtccctcctggcagaaagggtaatgaa
gatggttccccatacgccggccaggatgcaaattgtggcaacactcttctgatttctctt
gaagagcttgttaaggatggtttattgatgaaagaagagcttccaaaaccagttgatgca
gatcgtgtggacttctcaactgttgctgatataaaagatccgctgatagctaaggctgca
gagaggctcattctgagtgaaggggaactcaaaaatcattttgaagatttccgtagagat
cctgagatttcaaactggcttgaagattcggcttattttgctgctattgatgagactttg
aatacaatcagttggtatgattggcctgaacctttaaagaatcggcatctttccgccttg
gaagaaatttatcaaagcaaacgagattttataaacatattcattgcccaacaattctta
ttccaaaggcaatggcagaaagttcgtaactatgcgcagatgaaaggaatcaagataatg
ggagacatgcccatttatgtgggttatcacagtgcagatgtgtgggcaaataagaaacat
tttttactgaacaagagcggttttcctcttctagttagtggtgttcctcccgatgccttt
agtgaaactggccagctgtggggcagccctctctatgattggaaagccatggagagagat
agattttcttggtggatacgccgaatccgacgtgcacaaaatatatatgatgaattcaga
atagaccactttcgagggtttgctggctattgggctgttccttctgaagcaaaatttgca
atggatggacaatggaagatgggaccagggaaatcgttgtttgatgccatcttcagagct
gttggaaagatcaatattgttgcagaggacttgggtgtaatcaccgaggatgtaattcag
ctcaggaaatacatcagagcacctggaatggctgtcctccagtttggttttgggagtgat
gcagataacccacatttgcctcataatcacgagcaaaatgaagttgtttatactgggact
catgacaatgacacaacccgaggttggtgggatatcctagaacaagaggagaaatctaat
gtactaaagtatgtcacagttactggagaagatgatatctcatgggcactgatccaggct
gcactatcttcagtggcacaaactgctatcatacctatgcaagatgttctcgggttgggg
aattcagccaggatgaacatcccagcaactcagtctggcaattggggttggcggttacct
agttccatgagctttgatgacttggaatccgaagcaaagaaactgagagatctactttca
atctatgggcggctctga

DBGET integrated database retrieval system