KEGG   Vitis vinifera (wine grape): 100259566Help
Entry
100259566         CDS       T01084                                 

Definition
histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5-like
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100259566
Enzymes [BR:vvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100259566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 862 aa AA seqDB search
MVLSTSETSPMKTHKKRPFENHAHHQYRSFPPNFNRPRVDAVRDWPRGYGKFIPLTDSKV
IGDNIAVGTAGNFQAPVEHSIQSSFSSTIDAEVRMHEVPRSYPPKEVLKSYSIVRDFPEG
LKSASSSANNISPSEKFSAEPRPVEVMATCTKSPGQEMQDESAYNGALARRSYEGSNEVW
NNFRGEVGETSGFVGKWAGDAEEVCILLGQEIQDGDSFGSALKMSACKETGNEVRNDCSR
DFETYGVEGKWGVDAKEICASLGQEIQGGEACNRTLERSPWEATVNEVQNSSRDGETSGF
MVRRDDDTKEISIHPQSERKLSELDPWCQTVGNKDDRGKNVLRNTVKEIEICSKDHQAIG
NNSRVQGALNLFQELLEKLRREAILTGKKNVLRKLPVTAAMTLKRQQKWVNTTKRLGHVS
GIEVGDTFHYRVELAIIGLHSHFQNGIDYMEKDGKVLAISVVDSGRYANDKESSDVLIYL
GQGGNPMVGYNKQPEDQKLERGNLALKNSMDAKTPVRVTRGFQAMKVTSNGYTYDGLYFV
DKYWQERGQFGKLVFKFQLKRITGEPKFDQRELNQSKDSEVRWKTIFNDISLGRKLKKSK
KSKVCRKNILNDISLGKEERSIHVVNTIDYEKPQPFTYIARMAYLEGSKWSIPSGCDCTD
GCSDSVKCACVLKNGGEIPFNCHGAIIETKPWVYECGPLCKCPPSCNNRVSQNGIRFSLE
VFKTKSTGWGVRSRNYISSGSFICEYAGELIQDKEAKRRTANDEYLFDLDNGAFAIDAAK
FGNVGRYINHSCSPNLYAQKVLYDHDDKRLPHIMLFATKNIPPMRELTYHYNYMVGQVLD
INGQIKTKRCYCGSQECKGRMC
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggttttatcaacttccgaaacttctcctatgaagacacacaaaaaacggccatttgaa
aaccatgcccatcatcagtatcgaagttttcctccgaatttcaaccgtccaagggttgat
gctgttcgggattggccaagagggtatggaaaattcatccctctaactgactcaaaagta
attggagacaacattgccgttgggactgctggaaactttcaagctcctgttgagcatagt
attcagagtagcttcagttccacaattgatgctgaggttagaatgcatgaagttcctaga
agttatcctcccaaagaagtcttgaaaagctattctattgtcagggattttccagaaggt
ttaaaatctgcctcttcctctgctaacaatatttcccctagtgagaagttcagtgcagaa
cccaggcctgtagaagttatggcaacatgtacaaaatctcctggtcaggaaatgcaggac
gagagtgcttacaatggtgccttagcaaggaggtcttatgaaggaagcaatgaagtttgg
aataactttcgaggagaagttggtgaaacatctggttttgtgggaaaatgggctggtgat
gcagaagaagtctgcattttgcttggacaggaaattcaggatggagattcttttggaagt
gccttaaaaatgagtgcttgcaaagaaactggaaatgaagttcggaatgactgtagcaga
gattttgaaacatatggagttgagggcaaatggggtgttgatgcaaaagagatttgtgct
tcacttggacaggaaatacagggcggggaagcttgcaatcgtaccttagaaaggagtcct
tgggaagcaactgtcaatgaagttcagaatagttccagagatggtgagacatctggtttt
atggttagacgggatgatgatacaaaagaaatcagcattcacccccaatcagagaggaaa
ttgtctgaattggatccttggtgccagacagttggaaataaagatgatcgaggcaaaaat
gtgttgagaaatactgtgaaggaaattgaaatatgcagcaaggaccaccaggcaataggt
aacaacagtagagtacagggggctctaaatctattccaagagttattggaaaagctcaga
cgtgaagcaattctaacagggaaaaaaaatgttcttagaaagcttcctgtgacagcagca
atgactctcaagaggcaacaaaagtgggttaacacaactaagcgactaggtcatgtttct
ggtattgaagttggtgatacatttcattatagggttgaattggctattattggccttcat
agtcattttcagaatggtatagattacatggagaaggatggaaaagtattggccattagt
gttgttgattctggccgttatgccaatgacaaagaatcctctgatgtcttgatatatttg
ggtcaaggtggaaatccaatggttggatataataagcagcctgaagaccagaaacttgaa
cgaggaaaccttgcactgaagaatagcatggatgctaaaactcctgtaagggttacccga
ggttttcaagctatgaaagtgacttccaacggctacacttatgatggtctgtattttgtg
gacaagtattggcaggaaagaggtcaatttggtaaacttgtttttaaattccaactgaaa
agaattacaggagaaccaaagtttgatcaaagagaattgaatcagtcaaaagattcagaa
gtacgctggaaaactattttcaatgatatttctcttggcagaaaattgaagaagtcaaaa
aaatcaaaagtatgcaggaaaaatatcttaaacgatatttctttggggaaagaggagagg
tccatccatgtggtgaacacaattgattatgagaaacctcaacccttcacttacattgcc
cgcatggcatatttagagggttctaagtggtccattccaagtggttgtgattgcactgac
ggatgctcagattctgtgaaatgtgcttgtgtcctcaagaatggaggagagatcccattt
aactgccatggggctattattgagacaaagccctgggtttatgagtgtggtcctttgtgc
aagtgccctccttcttgtaacaatagagtcagccaaaatggtatcagattctcattggag
gttttcaagaccaaatcaacaggatggggtgttaggtctcgaaattatatttcatctgga
agttttatatgcgagtatgcaggggagctaattcaagacaaggaagccaaacgaaggact
gctaacgatgagtatttgtttgatttagataatggggcctttgccattgatgcagccaag
tttgggaatgtgggaagatatatcaaccatagttgttcacccaacctttatgcccaaaaa
gtcctttatgatcatgacgacaagagactgcctcatataatgctatttgctaccaagaac
ataccacccatgcgagaattaacatatcattacaattatatggtgggtcaggttcttgat
attaatggccaaatcaagacaaaaaggtgttactgtggttctcaagagtgcaaaggcagg
atgtgctga

DBGET integrated database retrieval system