KEGG   Vitis vinifera (wine grape): 100259631Help
Entry
100259631         CDS       T01084                                 

Definition
(RefSeq) eukaryotic translation initiation factor
  KO
K03259  
translation initiation factor 4E
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100259631
Messenger RNA biogenesis [BR:vvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100259631
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100259631
Translation factors [BR:vvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100259631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
5
AA seq 204 aa AA seqDB search
MASEAAGMESGAAGMESGAAPTEAAKQPHRLERKWTFWFDNQSKPKQGAAWGTSLRKAYT
FETVEEFWCLYDQIFKPSKLPANADFHLFKAGVEPKWEDPECANGGKWTVASSRKGNLDT
MWLETLMALIGEQFDEADEICGVVASVRQRQDKLALWTKTATNEAAQMSIGRKWKEVIDV
TDKITYSFHDDSRRERSVKVRYNV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgaggcggcagggatggagagcggcgcagcagggatggagagcggcgcagca
ccaacggaggcggccaagcagccacacaggctggagaggaagtggaccttctggttcgat
aaccagtccaagcccaagcaaggcgcggcttgggggacctctcttcgcaaggcttacacc
ttcgaaaccgtcgaagaattttggtgtctgtatgatcagatatttaagcccagcaagttg
ccagccaatgcagatttccatttgttcaaagctggggttgaaccaaaatgggaagatcct
gagtgtgcaaatggaggcaaatggactgttgccagcagccgaaagggtaatcttgatacc
atgtggctagaaacgttgatggccttaattggggagcaatttgatgaggctgatgaaata
tgtggtgtggttgcaagtgtacgtcaaaggcaggataagcttgctctgtggactaagaca
gcaaccaacgaggctgctcagatgagcattggaaggaagtggaaggaggtcattgatgtc
actgataagatcacttacagctttcatgatgattccagaagggaaagatcagtcaaagtt
cgatacaacgtgtga

DBGET integrated database retrieval system