KEGG   Vitis vinifera (wine grape): 100259769Help
Entry
100259769         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 9-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1013 aa AA seqDB search
MASSLNIVEKDGSQPFFPCNLGFHLFNSSSKIFNESQSFTADILRNCVFSLCSDLFRQFK
FSKIFRLKSIMTIADSGFMMENGGSCLPYTPEQEKQIVDDLMNKSESSLKEGNLYYVVSN
RWFTSWQRYIGQGNGEYPINGHLSDSQRLDAVPSKTAERPGPIDNSDIVLNGNECELDDL
EILRTLEEGRDYVLVPQEVWEKLFDWYKGGPALPRKMISQGITHKKFMVEIYRLCLKLTD
SRDNSQSVIRLSKKASVHELYERVCTLKVVEQEKARIWDYFNKRKQAILVASNQTLEESN
LQMDQDILLEVQLDGYWPSGFGMDSTGNELALVPMEPPRSSVSIAGGPTLSNGYSKVHTS
NLYQGSPLGSTFTDMEDGYDVLRSVAKGDRGGLAGLQNLGNTCFMNSAIQCLVHTPPIFE
YFLQDYTEEINKQNPLGMNGELAFAFGELLRKLWSSGRTPVAPRAFKGKLARFAPQFSGY
NQHDSQELLAFLLDGLHEDLNRVKQKPYIETKDSNGRPDEEVADECWRNHKARNDSLIVD
VCQGQYKSTLVCPVCSKISITFDPFMYLSLPLPSTVTRIMTVTVFYGDGSGLPMPYTVTV
LKHGYCKDLSQALAAACCLKSDENLLLAEVYEHRIYRYIENPSELLTNIKDEEHIVAYRL
PKKRAGLTRLEIIHRCQQQCTPDSLKGGERKLLGAPLVTYLGEDAQTGADIDIAVSRLLS
PLRRKTYPSSSNVHSGKENGSVSEATDNPTNSCNTQSGSGNQSTDGTELEEMSRWELSFQ
LSITDERGLSCKPIEKDSLIRPGQFIRVMLDWTDKEHELYDASYLRDLPEVHKNGFTAKK
TRPEAITLFSCLEAFLKEEPLGPQDMWYCPNCKEHRQATKKLDLWRLPDILVFHLKRFSY
SRYLKNKLDTLVNFPIHSLDLSQYVKCKDASSQSHVYELYAISNHYGGLGGGHYSAYAKL
IDENRWYHFDDSHVSPVGESEIKTSAAYVLFYQRVKAAPKIGTGEPSLGHTSS
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggccagctccttaaacatcgttgagaaagacggatcacagcctttcttcccctgcaat
ctagggttccatctcttcaattcctctagcaaaattttcaacgaatctcaatcattcact
gcagacattcttcgcaattgtgttttctctctgtgctccgatctcttccgccaattcaaa
ttcagtaaaattttcaggttgaaatcgattatgactattgctgattcgggttttatgatg
gaaaatggaggaagttgcttaccttacacaccggagcaagagaaacagattgttgatgat
ttgatgaataaatcagagtccagtttgaaagaaggcaacttgtactacgttgtttccaat
agatggtttacaagttggcagagatacattggacagggcaatggtgaatatccaattaat
gggcatttgtctgattcacagcgtttggatgcggttccatcaaagacagcagagagacct
ggacctattgataattctgatattgttttaaatggaaatgaatgtgaacttgatgatctg
gagattcttagaacgctagaggagggacgtgattatgttttagttcctcaagaagtttgg
gagaagctttttgactggtataaaggaggaccggcattacccagaaagatgatttctcaa
ggtattactcacaagaaattcatggtggagatttaccgactatgccttaagttaactgat
tccagagacaacagtcaatcagttataaggttgagtaaaaaggcttctgtgcatgagctt
tatgagagggtgtgtacacttaaagtggtagagcaggaaaaggcccgcatatgggactat
ttcaataagcggaaacaagcaatattagttgcttcaaaccaaactcttgaggaatctaac
ttgcagatggaccaagatattcttttggaggtgcaacttgatggatattggccctctgga
tttggcatggattcaaccggaaatgaactggctttggtaccaatggaacctccaagatcc
tctgtatcaattgcaggaggcccaaccctctcaaatggttattccaaagttcatacctcc
aatttgtatcagggaagtcctttaggttcaacatttacagatatggaggatggatatgat
gttttgaggagtgtagcaaaaggagataggggaggtttggcaggattgcagaatctagga
aacacttgctttatgaacagtgctattcagtgtttagtacatacaccccccatatttgag
tatttcttgcaagactacaccgaggagatcaacaaacaaaatccattaggaatgaatggt
gagcttgcatttgcttttggtgaattgttgaggaaattatggtcctctggccggacacca
gttgcacctcgtgcatttaagggaaaacttgctcgatttgctcctcagttcagtgggtat
aatcagcacgattctcaagaacttcttgctttcttactggatggactgcatgaagatttg
aatcgtgtaaaacaaaagccatatattgaaacaaaggattcaaatggtcgcccagatgag
gaagttgctgacgagtgttggaggaatcataaagctcggaatgattcattaattgtggat
gtttgccagggtcaatataagtcaactctggtttgcccagtttgcagcaaaatttcaata
acatttgatccgttcatgtatttgtcattgccgctgccttcaacggtcactcggataatg
acggtgactgtgttctatggtgatggaagtggccttccaatgccctacactgtgacagtg
ctaaaacatggttactgtaaagatcttagccaggcattggctgctgcatgctgcttgaag
agtgatgaaaatctactgcttgctgaggtctacgaacatcggatatatcgatacatagag
aatccttcggagttattgactaatataaaggatgaggaacatattgtggcttaccgtctt
cctaagaaacgagcaggattaacaagactggagataattcataggtgtcagcaacaatgt
acaccagacagtctgaagggtggtgagaggaagcttttgggagcaccactagttacttat
ttaggagaggatgctcaaactggagctgatattgacattgccgtttctagattgctctct
ccattgagaaggaaaacatatccctcttcgtctaatgttcatagtggcaaggaaaatggc
tccgtttcagaagctactgataatcctacaaacagctgcaatactcaatctggatctggg
aaccagtcgacagatggcacagaactagaagaaatgtccagatgggagttgtccttccag
ctttccattactgatgaaaggggtttgagctgcaagcctattgaaaaggattctctcata
agacctggtcaatttatacgggttatgttggactggactgacaaagaacatgaattatat
gatgccagctacctcagggatcttcctgaggttcataagaatgggttcaccgcaaagaag
accaggccagaagctatcaccctgttttcatgcttggaggcattcctgaaagaagaacct
ctaggacctcaagacatgtggtattgccctaattgcaaggaacatagacaagccaccaag
aaattggacttgtggaggttgccagatattcttgtgtttcacttgaaacgattttcatac
agccgatacctgaagaacaaacttgatacccttgtaaattttcccattcatagtcttgac
ttgagccaatatgtgaaatgcaaggatgcatcttcacaatctcatgtttatgagctatat
gccatcagcaaccattatggtggcctaggcggtgggcactactctgcctatgcaaagttg
attgatgaaaacagatggtaccatttcgatgacagccatgtttctcccgttggcgagagc
gagatcaagacatcagctgcatatgtgttattctatcaacgagttaaagcagctccaaag
attggaacaggggagccttctctgggtcatacaagttcttga

DBGET integrated database retrieval system