KEGG   Vitis vinifera (wine grape): 100259769Help
Entry
100259769         CDS       T01084                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 9
Organism
vvi  Vitis vinifera (wine grape)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 943 aa AA seqDB search
MTIADSGFMMENGGSCLPYTPEQEKQIVDDLMNKSESSLKEGNLYYVVSNRWFTSWQRYI
GQGNGEYPINGHLSDSQRLDAVPSKTAERPGPIDNSDIVLNGNECELDDLEILRTLEEGR
DYVLVPQEVWEKLFDWYKGGPALPRKMISQGITHKKFMVEIYRLCLKLTDSRDNSQSVIR
LSKKASVHELYERVCTLKVVEQEKARIWDYFNKRKQAILVASNQTLEESNLQMDQDILLE
VQLDGYWPSGFGMDSTGNELALVPMEPPRSSVSIAGGPTLSNGYSKVHTSNLYQGSPLGS
TFTDMEDGYDVLRSVAKGDRGGLAGLQNLGNTCFMNSAIQCLVHTPPIFEYFLQDYTEEI
NKQNPLGMNGELAFAFGELLRKLWSSGRTPVAPRAFKGKLARFAPQFSGYNQHDSQELLA
FLLDGLHEDLNRVKQKPYIETKDSNGRPDEEVADECWRNHKARNDSLIVDVCQGQYKSTL
VCPVCSKISITFDPFMYLSLPLPSTVTRIMTVTVFYGDGSGLPMPYTVTVLKHGYCKDLS
QALAAACCLKSDENLLLAEVYEHRIYRYIENPSELLTNIKDEEHIVAYRLPKKRAGLTRL
EIIHRCQQQCTPDSLKGGERKLLGAPLVTYLGEDAQTGADIDIAVSRLLSPLRRKTYPSS
SNVHSGKENGSVSEATDNPTNSCNTQSGSGNQSTDGTELEEMSRWELSFQLSITDERGLS
CKPIEKDSLIRPGQFIRVMLDWTDKEHELYDASYLRDLPEVHKNGFTAKKTRPEAITLFS
CLEAFLKEEPLGPQDMWYCPNCKEHRQATKKLDLWRLPDILVFHLKRFSYSRYLKNKLDT
LVNFPIHSLDLSQYVKCKDASSQSHVYELYAISNHYGGLGGGHYSAYAKLIDENRWYHFD
DSHVSPVGESEIKTSAAYVLFYQRVKAAPKIGTGEPSLGHTSS
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctgattcgggttttatgatggaaaatggaggaagttgcttaccttacaca
ccggagcaagagaaacagattgttgatgatttgatgaataaatcagagtccagtttgaaa
gaaggcaacttgtactacgttgtttccaatagatggtttacaagttggcagagatacatt
ggacagggcaatggtgaatatccaattaatgggcatttgtctgattcacagcgtttggat
gcggttccatcaaagacagcagagagacctggacctattgataattctgatattgtttta
aatggaaatgaatgtgaacttgatgatctggagattcttagaacgctagaggagggacgt
gattatgttttagttcctcaagaagtttgggagaagctttttgactggtataaaggagga
ccggcattacccagaaagatgatttctcaaggtattactcacaagaaattcatggtggag
atttaccgactatgccttaagttaactgattccagagacaacagtcaatcagttataagg
ttgagtaaaaaggcttctgtgcatgagctttatgagagggtgtgtacacttaaagtggta
gagcaggaaaaggcccgcatatgggactatttcaataagcggaaacaagcaatattagtt
gcttcaaaccaaactcttgaggaatctaacttgcagatggaccaagatattcttttggag
gtgcaacttgatggatattggccctctggatttggcatggattcaaccggaaatgaactg
gctttggtaccaatggaacctccaagatcctctgtatcaattgcaggaggcccaaccctc
tcaaatggttattccaaagttcatacctccaatttgtatcagggaagtcctttaggttca
acatttacagatatggaggatggatatgatgttttgaggagtgtagcaaaaggagatagg
ggaggtttggcaggattgcagaatctaggaaacacttgctttatgaacagtgctattcag
tgtttagtacatacaccccccatatttgagtatttcttgcaagactacaccgaggagatc
aacaaacaaaatccattaggaatgaatggtgagcttgcatttgcttttggtgaattgttg
aggaaattatggtcctctggccggacaccagttgcacctcgtgcatttaagggaaaactt
gctcgatttgctcctcagttcagtgggtataatcagcacgattctcaagaacttcttgct
ttcttactggatggactgcatgaagatttgaatcgtgtaaaacaaaagccatatattgaa
acaaaggattcaaatggtcgcccagatgaggaagttgctgacgagtgttggaggaatcat
aaagctcggaatgattcattaattgtggatgtttgccagggtcaatataagtcaactctg
gtttgcccagtttgcagcaaaatttcaataacatttgatccgttcatgtatttgtcattg
ccgctgccttcaacggtcactcggataatgacggtgactgtgttctatggtgatggaagt
ggccttccaatgccctacactgtgacagtgctaaaacatggttactgtaaagatcttagc
caggcattggctgctgcatgctgcttgaagagtgatgaaaatctactgcttgctgaggtc
tacgaacatcggatatatcgatacatagagaatccttcggagttattgactaatataaag
gatgaggaacatattgtggcttaccgtcttcctaagaaacgagcaggattaacaagactg
gagataattcataggtgtcagcaacaatgtacaccagacagtctgaagggtggtgagagg
aagcttttgggagcaccactagttacttatttaggagaggatgctcaaactggagctgat
attgacattgccgtttctagattgctctctccattgagaaggaaaacatatccctcttcg
tctaatgttcatagtggcaaggaaaatggctccgtttcagaagctactgataatcctaca
aacagctgcaatactcaatctggatctgggaaccagtcgacagatggcacagaactagaa
gaaatgtccagatgggagttgtccttccagctttccattactgatgaaaggggtttgagc
tgcaagcctattgaaaaggattctctcataagacctggtcaatttatacgggttatgttg
gactggactgacaaagaacatgaattatatgatgccagctacctcagggatcttcctgag
gttcataagaatgggttcaccgcaaagaagaccaggccagaagctatcaccctgttttca
tgcttggaggcattcctgaaagaagaacctctaggacctcaagacatgtggtattgccct
aattgcaaggaacatagacaagccaccaagaaattggacttgtggaggttgccagatatt
cttgtgtttcacttgaaacgattttcatacagccgatacctgaagaacaaacttgatacc
cttgtaaattttcccattcatagtcttgacttgagccaatatgtgaaatgcaaggatgca
tcttcacaatctcatgtttatgagctatatgccatcagcaaccattatggtggcctaggc
ggtgggcactactctgcctatgcaaagttgattgatgaaaacagatggtaccatttcgat
gacagccatgtttctcccgttggcgagagcgagatcaagacatcagctgcatatgtgtta
ttctatcaacgagttaaagcagctccaaagattggaacaggggagccttctctgggtcat
acaagttcttga

DBGET integrated database retrieval system