KEGG   Vitis vinifera (wine grape): 100259931Help
Entry
100259931         CDS       T01084                                 

Definition
pyruvate dehydrogenase E1 component subunit beta-like
Orthology
K00162  
pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:vvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vvi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vvi00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 402 aa AA seqDB search
MAAIFQGIGAAAALPSAKKFHSQSRRFVSARKGSLFVVRSDGRPSXGSSPRSRGAQHLIT
NAVAAKADASATSTASKPGHELLLFEALREGLEEEMDRDPLVCVMGEDVGHYGGSYKVTK
GLAAKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLH
YTSGGQFKIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAI
RSENPVILFEHVLLYNLKERIPDDEYVLSLEEAEMVRPGEHVTILTYSRMRYHVMQAAKT
LVNKGYDPEVIDIRSLKPFDLYTIGNSVKKTHRVLIVEECMRTGGIGASLTAAITENFID
YLDAPIVCLSSQDVPTPYAGTLEEWTVVQPAQIVTAVEQLCQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatttttcaagggatcggcgctgcagcggctctgccttctgccaagaaattc
cactcacaatctcgcagattcgtctcagcgaggaaaggaagcttgtttgtggtcagatct
gatgggaggccatcgnctggttcttccccgcggagccgcggtgctcaacacttgattact
aatgcagttgcagcgaaggcggatgcttctgcgacctcaactgcatctaaacctgggcat
gagcttctactatttgaagcccttcgagaaggcctggaagaagaaatggacagagatccc
ctagtatgcgtaatgggtgaagatgtgggccactatggaggctcctacaaggtgacaaag
ggcctggctgcaaagtatggggatctcagggttcttgacacacccattgctgaaaactcc
ttcactggcatgggcattggagctgccatgactgggttaaggccaattatcgaggggatg
aacatgggatttctccttttagctttcaaccagatctccaacaactgtggcatgctccac
tatacatctggcggccagttcaaaataccagtggttatcagaggacctggtggagttggt
cggcagcttggggctgagcactcacaacgccttgaatcatatttccaatcaatacctgga
atccaaatggtggcatgctcaaccccttacaatgccaagggcttgatgaaagctgcaata
cggagtgagaacccagtgatcctttttgagcatgttttgctttacaatctcaaggagagg
attccagatgatgagtatgtgttatcactcgaggaagcagagatggtaagacctggggaa
catgtcaccattttgacctattctaggatgaggtatcatgtgatgcaggctgccaaaaca
ttggtgaacaaggggtatgatcctgaggttattgatatcaggtccttgaaaccatttgat
ctttacacgattgggaattcagtgaagaagacacaccgtgtgctgattgtggaggagtgc
atgcggacaggtgggatcggtgccagtttgacagctgctatcactgagaatttcattgat
tacttggatgccccgatcgtttgtctgtcatcacaggatgtgcccaccccatatgctggg
acattggaggaatggactgtggtgcagcctgcacagattgtgacggctgttgaacagctt
tgccagtag

DBGET integrated database retrieval system