KEGG   Vitis vinifera (wine grape): 100259931Help
Entry
100259931         CDS       T01084                                 

Definition
pyruvate dehydrogenase E1 component subunit beta-like
Orthology
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100259931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100259931
   00020 Citrate cycle (TCA cycle)
    100259931
   00620 Pyruvate metabolism
    100259931
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     100259931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 402 aa AA seqDB search
MAAIFQGIGAAAALPSAKKFHSQSRRFVSARKGSLFVVRSDGRPSXGSSPRSRGAQHLIT
NAVAAKADASATSTASKPGHELLLFEALREGLEEEMDRDPLVCVMGEDVGHYGGSYKVTK
GLAAKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLH
YTSGGQFKIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAI
RSENPVILFEHVLLYNLKERIPDDEYVLSLEEAEMVRPGEHVTILTYSRMRYHVMQAAKT
LVNKGYDPEVIDIRSLKPFDLYTIGNSVKKTHRVLIVEECMRTGGIGASLTAAITENFID
YLDAPIVCLSSQDVPTPYAGTLEEWTVVQPAQIVTAVEQLCQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatttttcaagggatcggcgctgcagcggctctgccttctgccaagaaattc
cactcacaatctcgcagattcgtctcagcgaggaaaggaagcttgtttgtggtcagatct
gatgggaggccatcgnctggttcttccccgcggagccgcggtgctcaacacttgattact
aatgcagttgcagcgaaggcggatgcttctgcgacctcaactgcatctaaacctgggcat
gagcttctactatttgaagcccttcgagaaggcctggaagaagaaatggacagagatccc
ctagtatgcgtaatgggtgaagatgtgggccactatggaggctcctacaaggtgacaaag
ggcctggctgcaaagtatggggatctcagggttcttgacacacccattgctgaaaactcc
ttcactggcatgggcattggagctgccatgactgggttaaggccaattatcgaggggatg
aacatgggatttctccttttagctttcaaccagatctccaacaactgtggcatgctccac
tatacatctggcggccagttcaaaataccagtggttatcagaggacctggtggagttggt
cggcagcttggggctgagcactcacaacgccttgaatcatatttccaatcaatacctgga
atccaaatggtggcatgctcaaccccttacaatgccaagggcttgatgaaagctgcaata
cggagtgagaacccagtgatcctttttgagcatgttttgctttacaatctcaaggagagg
attccagatgatgagtatgtgttatcactcgaggaagcagagatggtaagacctggggaa
catgtcaccattttgacctattctaggatgaggtatcatgtgatgcaggctgccaaaaca
ttggtgaacaaggggtatgatcctgaggttattgatatcaggtccttgaaaccatttgat
ctttacacgattgggaattcagtgaagaagacacaccgtgtgctgattgtggaggagtgc
atgcggacaggtgggatcggtgccagtttgacagctgctatcactgagaatttcattgat
tacttggatgccccgatcgtttgtctgtcatcacaggatgtgcccaccccatatgctggg
acattggaggaatggactgtggtgcagcctgcacagattgtgacggctgttgaacagctt
tgccagtag

DBGET integrated database retrieval system