KEGG   Vitis vinifera (wine grape): 100260799Help
Entry
100260799         CDS       T01084                                 

Definition
lecithin-cholesterol acyltransferase-like 1
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100260799
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100260799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 426 aa AA seqDB search
MKGLGLIFAMVSMAVMWYTCQASSNLHPLILVPGSGGNQLEARLTDGYKPSSLLCSRLYP
PLKDKEGWFRLWFDPAQVVGPFTQCFAQRMMLYYDPQLDDYVNTPGVETRVPSFGSTRSL
LHLDPHLKRITAYMGPLVKSLEQMGYVDGETLFGAPYDFRYGLAADGHPSRVGSKFLEDL
KDLIEKASTSNGGKPVILVSHSLGGLFVLQLLNRNPPAWRQKFIKHFVALSAPWGGAVQE
VHTLASGYTLGVPLVDPLLVREQQRSSESNLWLMPSPKVFGAKQPLVVTLNATYTAYDIV
QFLNDIGFPEGIHPYQSRTVPLLEHLPAPEVPVTCIIGSGVRTSETLFYDESGFDRQPEI
VYGDGDGTVNMVSLLALESEWADQQNQSLKMVTIEGASHTSIIKDENALNRIVEEISGIN
SYTYSS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattgggcttaatattcgcgatggtttcgatggccgtgatgtggtacacatgt
caggcgagcagcaacctccaccctctgatcctggtgccggggagtggtggaaatcagcta
gaagcaaggcttacggatgggtacaaaccgtcgagcttgctgtgcagccgactctatccg
cctttgaaggacaaagaagggtggttcaggctgtggttcgaccccgcccaagtcgttggt
ccattcactcaatgctttgcccagcggatgatgctttactatgacccacaacttgatgat
tatgtaaatacccctggtgttgaaaccagggtccctagctttggttctactcgctccctt
cttcatttagatcctcatctcaagcgcatcacagcatacatggggcccctggtgaaatct
ctggagcaaatgggttacgttgatggcgaaacattattcggagctccatatgactttcga
tacggtctagcggcagatggtcacccatcacgtgttggttccaagttccttgaggacctc
aaagatttgatagaaaaagcaagcacttccaatggaggaaagccagtaatacttgtctcc
cacagcttgggaggcctctttgtcctccaacttctcaaccgaaaccccccagcttggcgt
cagaaattcatcaagcacttcgtcgcactgtccgctccttggggtggcgcagtgcaggaa
gtgcacacccttgcttctggctacactctgggagtacccctagttgatccattgctggtg
agggagcagcagaggagctcagagagcaacttatggctcatgccttctcctaaagtcttt
ggtgccaaacaaccactcgtggttacattaaatgctacttatacagcatacgatattgtg
cagttcctcaatgacattgggttcccggaagggatccatccttaccaatctcgcactgtg
cctttgttggaacacttaccagcgcctgaggtgcccgtcacctgtataatcgggagtggc
gttagaacatccgagacactgttctatgatgaaagtggctttgatagacaaccagagatt
gtttacggggatggagatgggacagtgaacatggtgagcttgttagcacttgaatcggag
tgggccgaccaacaaaatcagtcccttaagatggttaccattgaaggggcatctcataca
tccataatcaaagacgaaaatgcacttaatagaatagtagaagaaatttcaggtattaat
tcttatacctattcatcatga

DBGET integrated database retrieval system