KEGG   Vitis vinifera (wine grape): 100260894Help
Entry
100260894         CDS       T01084                                 

Gene name
CBL01
Definition
calcineurin B-like protein 01
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
vvi  Vitis vinifera (wine grape)
Brite
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100260894 (CBL01)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 213 aa AA seqDB search
MGCFQSTARKQFPGHEDPVILASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLA
LFKNRKKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSFKLYDLDS
TGFIERQEVKQMLIALLCESEMKLADETIEIILDKTFLEADVNQDGRIDKSEWQNFVSRN
PSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctttcagtcaacagcaagaaagcagtttcctggacatgaggacccagtaatt
cttgcttcccaaacagcttttagtgtgagtgaagttgaagcactatttgagctattcaag
agcattagtagttctgtaattgatgatgggttaataaacaaggaagagtttcaattggct
ctattcaagaacagaaagaaggagaatctctttgcaaataggatctttgatctttttgat
gttaagcggaagggagtcattgattttggtgactttgtcaggtcactaaatgttttccat
ccaaatgccccacaagaagacaaaattgatttttcattcaagctctatgatttggatagc
acaggattcattgagcggcaagaggtcaaacaaatgttaattgcacttctgtgcgaatct
gaaatgaagttggctgatgaaaccatcgagataatacttgataagacgttcttggaagct
gacgtaaatcaggatgggaggattgataaatctgagtggcagaattttgtttctcggaac
ccatcattgttgaagataatgacactaccatatctaagggacataacgacaacctttccg
agctttgtgtttaattcagaggtggatgagattgctacataa

DBGET integrated database retrieval system