KEGG   Vitis vinifera (wine grape): 100261121Help
Entry
100261121         CDS       T01084                                 

Definition
(RefSeq) profilin-1
  KO
K05759  
profilin
Organism
vvi  Vitis vinifera (wine grape)
Brite
Membrane trafficking [BR:vvi04131]
 Others
  Actin-binding proteins
   Others
    100261121
Cytoskeleton proteins [BR:vvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100261121
Exosome [BR:vvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100261121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 191 aa AA seqDB search
MRKKRGHQVGERGVSLQLLNPYATFSTYISSSISTLLLARFLILHPFIFFTTPLPKPFIK
MSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSATFPQFKPEEITAIMTDFAEPGTL
APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGACIKKTIQALIIGIYDEPLTPGQCNMIVE
RLGDYLIDQGL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagaagagaggccaccaggttggagaaagaggtgtgtcactgcagctgcttaat
ccctacgctaccttctcaacctatatttcttcctccatttccactctcctcctcgcccgc
ttcctcatcctccatccttttatattcttcaccactccacttcccaaacctttcatcaag
atgtcgtggcaaacctatgttgatgaccatctcatgtgcgaaattgaaggcaatcatctc
actgccgctgctatcctcggccaagacggcagcgtttgggctcagagtgccaccttccct
cagttcaagcccgaagaaattactgccataatgactgattttgctgagcctggtacgctt
gcaccaactggcttataccttggtggcacaaagtatatggtgatccaaggtgaaccaggg
gctgtcattcgaggcaaaaagggctctggtggtgcctgtattaagaagaccattcaggct
ttgatcattggtatatatgatgagcctctgactcctggtcagtgcaacatgattgttgaa
aggctgggtgattatctcattgatcagggtctttag

DBGET integrated database retrieval system