KEGG   Vitis vinifera (wine grape): 100261294Help
Entry
100261294         CDS       T01084                                 

Definition
(RefSeq) steroid 5-alpha-reductase DET2
  KO
K09591  steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00905  Brassinosteroid biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Module
vvi_M00371  Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    100261294
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100261294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 ERG4_ERG24 PEMT
Motif
Other DBs
NCBI-GeneID: 100261294
NCBI-ProteinID: XP_002277900
UniProt: D7THB8
Position
8
AA seq 257 aa AA seqDB search
MDWDRTLFHNSLIALYLIAPPTFISLRFLQAPYGKHHRSGWGPTVPPSLAWFLMESPTVW
LTLLIYPLGDRSSNPRSLILISIYLFHYIHRTLIYPLHLRNSTAAKRNGFPVSVALMAFG
FNLLNAYLQARWVSHYANYEDDGWFWWRFWVGLVIFLDGMLVNVRSDLALVGLKSQGGGY
KVPRGGWFELVSCANYFGEVVEWLGWAVMTWSWVGLGFLLYTCANLVPRARANHKWYLEK
FGEDYPKGRKAVIPFLY
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggattgggaccgaaccctgttccacaactctctcatcgccctctacctcatcgcccca
cccacattcatctcccttcgtttcctccaagccccctatggcaagcaccaccgatcgggg
tggggtcccactgtgccgccatccttggcatggttcctcatggaatctcctactgtgtgg
ttgacgctcctcatctaccccttgggtgatcgttcctccaatcccagatccctaatcctc
atttccatctacctcttccactacatccatcgtactctcatctaccctcttcacctccgc
aactccactgccgctaaacggaatgggttcccggtcagcgtggcgctcatggcctttgga
ttcaacctcctgaacgcctacttgcaagccagatgggtgtctcattatgctaattacgag
gacgatgggtggttctggtggcggttctgggtgggactggtaatcttcctggatgggatg
ttggtgaatgtaagatcggatttggcgttggtgggtctgaaaagccagggcggagggtac
aaggtgccgagaggagggtggttcgagttagtgagctgtgccaactatttcggggaggtg
gtggagtggttgggatgggcggtgatgacgtggtcttgggtgggtttagggtttcttctg
tacacatgtgccaatttggtgccaagggcacgtgccaaccacaagtggtatttggaaaag
tttggggaggattatcccaaggggagaaaagctgttattcccttcctctattga

DBGET integrated database retrieval system