KEGG   Vitis vinifera (wine grape): 100261596Help
Entry
100261596         CDS       T01084                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic-like
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100261596
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     100261596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 394 aa AA seqDB search
MAMASSQFFCDHQLHPSCNSIRRTTLPSFRPHGSSSFRPKPQFQRTPFLRVRASAGRKQV
EIVYNPDERINNLADEVDKNAGLSRLTLFSPCKINVFLRITGKRADGFHDLASLFHVISL
GDIIKFSLSPSKTKDRLSTNVPGVPLDESNLIIKALNLYRKKTGTDNYFWVHLDKKVPTG
AGLGGGSSNAATALWAANQFSGCLATEKELQQWSSEIGSDIPFFFSNGAAFCTGRGEVVE
DISLPIPLDIPMVLVKPPQACSTAEVYKHLRLDQTSKVDPITLLEKISKNRISQDVCIND
LEPPAFEVLPSLKRLKQRIIAASRGQYDAVFMSGSGSTIVGIGSPDPPQFIYDDDEYQDV
FLSEASFITRAANQWYTQPASTGACYNSPNQSME
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcttcatcacaattcttctgcgatcaccaacttcacccttcctgcaattcc
atcagaagaaccaccctcccttcatttagaccacatgggtcatcttcttttcgtccaaaa
ccccaatttcagaggactccatttctcagagtcagggcttctgctggtagaaaacaagtg
gagatagtgtataatccagatgaaaggataaacaatctagcagatgaagtggataagaac
gctgggctttcaaggctcactctattttcaccttgcaagattaatgttttcctgagaata
accggtaagagagcagatggatttcatgatttggcatctctctttcatgtaatcagttta
ggagatataattaagttctctttgtcgccatcaaaaacaaaggatcgcttatcaaccaat
gtgccaggggtcccccttgatgaaagtaatttgatcataaaggcacttaacctttacagg
aaaaaaactggcactgataactacttttgggttcatcttgataaaaaggtgccgactggg
gcagggcttggtggtggcagcagtaatgctgcaacagcactgtgggcagcaaatcaattt
agtggttgccttgccactgagaaggaactccaacaatggtcaagtgagattggttcggat
attccattcttcttctctaatggagcagctttttgtactggcagaggtgaggttgttgaa
gatatttccctgccaatacctttggacattccaatggttcttgtaaagccaccgcaggca
tgctccaccgctgaagtttacaagcaccttcggttggatcaaactagtaaggttgatccc
ataaccttgcttgagaagatctcaaagaacagaatatctcaagatgtttgtataaatgat
ctagaacctcctgcatttgaagtcctcccatctctgaaaagattaaaacagcgtataatt
gcagcaagccgtggacaatatgatgctgttttcatgtctgggagtggaagcactattgtg
ggtattggttctccagatcctccacaatttatctatgatgatgatgaatatcaggatgtg
tttttgtcagaagccagcttcatcactcgtgcagccaatcaatggtacacccaaccggct
tcaactggtgcttgttataactcaccaaaccaatccatggagtga

DBGET integrated database retrieval system