KEGG   Vitis vinifera (wine grape): 100261704Help
Entry
100261704         CDS       T01084                                 

Definition
tryptophan synthase beta chain 2-like
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100261704
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100261704
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100261704
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100261704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 483 aa AA seqDB search
MSSIFSLHSVGEQGKPMLLRASPRCRVRARAASSKAGPQAVEIPHQWYNLIADLPVKPPP
ALHPQTQEPIKPEDLSPLFPDELIKQEASTDRFIAIPEEVIDVYRLWRPTPLIRAKRLEK
LLDTPARIYYKYEGVSPAGSHKPNTAVPQVWYNAQEGVKSVTTETGAGQWGSSLAFACSL
FGLDCEVWQVRASYDQKPYRNLMMQTWGAKVHPSPSSITEAGRKILQMNPSSPGSLGIAI
SEAVEVAAANADTKYCLGSVLNHVLLHQTVIGEECIKQMEAIGETPDVIIGCTGGGSNFG
GLTFPFIREKLKGRINPLIRAVEPTACPSLTKGVYAYDYGDTAGMTPLMKMHTLGHDFVP
DPIHAGGLRYHGMAPLLSHVYELGFMEAISIPQIECFQGAIQFARTEGLIPAPEPTHAIA
ATIREALHCRETGESKVILTAMCGHGHFDLPAYEKYLQGNMVDLSFEEEKIKASLANIPQ
VVA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaatcttttctttgcattcagttggggagcaagggaagcctatgctcctgagg
gcttcacctaggtgcagagtcagagcaagagctgcatcttccaaggctgggcctcaagca
gttgaaattcctcatcagtggtacaatttaattgcagaccttccagttaaacctcctcca
gctctgcatccccagactcaggaaccaatcaaacctgaagatttgtctcccctgtttcca
gatgaattgatcaagcaagaggctagcactgacaggttcattgcaatcccagaggaagtt
attgatgtttatcggctttggcgtccaacacctctgatcagagccaagaggttggagaag
cttcttgacacacctgccaggatttattacaagtatgaaggtgttagcccagctggatcc
cacaaacccaacactgcagtcccacaagtctggtataatgcacaagaaggcgtcaagagt
gttactactgaaaccggtgctggccaatggggaagttcactggcctttgcttgcagctta
tttggccttgactgtgaagtgtggcaagttcgcgcttcttatgatcagaaaccatatcgt
aatctgatgatgcaaacttggggtgcaaaagtgcatccatctccatctagcatcactgag
gcaggccgaaaaatccttcagatgaatccatcaagcccaggcagtttaggaatagctatt
tcagaggctgtggaggttgcagccgccaatgctgataccaagtactgtctgggaagtgtt
ctcaatcatgttttgctacaccagaccgttataggcgaggagtgcataaaacagatggaa
gccatcggtgagaccccagatgtgatcattgggtgtactggtggtggttctaattttggt
gggctcacttttccttttattagagagaagctcaaagggagaatcaaccctcttataagg
gcagttgaacctacagcatgcccttcattaacaaaaggtgtatatgcctatgattatggc
gatacagcaggaatgactcctttgatgaagatgcatacacttgggcatgacttcgttcct
gatcctattcatgcaggcggtttgcgttaccatggtatggcaccattgctttcacatgtc
tatgaactgggtttcatggaagcaatctcaattcctcagattgaatgctttcaaggtgct
atacaatttgctaggacagaaggattaataccagcaccggagccaactcatgccattgct
gctaccatcagggaagctctccattgcagagagactggagaatcaaaggtcattctcacg
gcaatgtgcggacacggccattttgaccttccagcctatgagaagtatttgcaaggaaat
atggttgatttgtcatttgaggaggagaagataaaagcatccctagccaacatccctcaa
gtggtggcctga

DBGET integrated database retrieval system