KEGG   Vitis vinifera (wine grape): 100261752Help
Entry
100261752         CDS       T01084                                 

Definition
NAD-dependent deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100261752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 467 aa AA seqDB search
MSLGYAEKLSYIEDVGKVGMSEICDPLHVLQEKIERLAVMLRKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKALPQASLPFHRAMPSMTHMALVELEKAGILKFVISQNIDGLH
LRSGIPRDKLAELHGNSFMEICSSCGIEYLRDFEVETIGLKETSRRCSNVDCGAKLRDTV
LDWEDALPPKEMNPAEKHCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQETP
KDKKASLVIHGFVDKVIAGVMDRLNMRIPPFVRIDLFQVILTHTLSSDKRFVNWILRVAS
VHGQKAPLPFIKYVEVSFLDGQNYKEAVLHKQPFQLKRRTVKTKIFEVLLKLNFSDGCGC
LSSQIKVPIDFKVSTDCFNYDKDAILQKLRDTATGDPCCGRHEVIEKKPIPDPRSEATVY
AIVTNVLQYNKTAPESNGSVMKGRLGGLNGIETSWKRSRSGKRKPRS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgggctacgcagagaagctttcatacatagaagatgtgggcaaagttggaatg
tcagaaatttgtgacccactccatgttctgcaggaaaaaattgaacgacttgctgtgatg
ctacggaagagtaagcacctagtggtgttcacaggtgctggaatatcaacttcttgtggt
atacctgattttcgaggtccaaagggtatttggacacttcagcgtgaaggcaaagccttg
ccacaagcatcactgccatttcatcgtgcaatgccaagcatgactcatatggctttggtt
gaactagagaaagctggtatcctaaagtttgtcattagtcagaatattgatggcctccat
cttcgttctggaataccaagggataagcttgctgaattgcatgggaactccttcatggaa
atttgttcttcctgtggaattgagtacttgcgggattttgaggtggaaactattggattg
aaggagacatcacgacgttgttccaatgtagactgtggagcgaaactcagggatacagtt
cttgactgggaggatgcgttgcctccaaaggagatgaatccagcagagaagcactgcaga
atggctgatgttgtattatgccttgggacaagtttgcagatcactcctgcatgcaacctc
cctctaaaatccctccgtggtggggggaagattgtaattgtgaatcttcaggaaactcca
aaggacaagaaagcaagtttggtgattcatgggtttgtagataaggtaattgcaggtgtc
atggaccgacttaatatgcggattcctccatttgttcgaattgatcttttccaagtcatt
ctaactcataccctgagttcagataaaagatttgtgaattggatcctcagagtagcaagt
gtacatggacagaaagctccattaccatttatcaaatatgttgaggtttcctttttagat
gggcaaaattataaagaagctgtcctgcataagcaaccatttcagctaaagaggagaaca
gtgaaaaccaaaatatttgaagtgcttttgaaactcaacttcagtgatggttgtgggtgt
ctgtcctctcaaattaaagtcccaattgatttcaaggtttcgacagactgttttaactat
gataaagatgccatcctccaaaagctgagagatacagcaaccggggatccatgctgtgga
cggcatgaagtcatagagaaaaagcccatcccagatcctagaagtgaagcgaccgtttat
gcgattgtaaccaatgtcttgcagtacaacaagactgcacctgaaagcaatggtagtgtg
atgaaaggtcgacttgggggtttgaatggtattgaaacatcttggaagcgatcaagaagt
ggtaagaggaagcctagatcatag

DBGET integrated database retrieval system