KEGG   Vitis vinifera (wine grape): 100261889Help
Entry
100261889         CDS       T01084                                 

Definition
regulatory-associated protein of TOR 1-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1363 aa AA seqDB search
MALGDLMASRFSQSSVAVSNHLDECSSHEDGDLNSNRRDRDSDAASSSYTNATATTSMAY
FPQNIVLCELRHEAFEACAPSGPSDSGLVSKWRPKDRMKTGCVALVLCLNISVDPPDVIK
ISPCARMECWIDPFSMAPQRALEMIGKNLSAQYERWQPKARCKYQLDPTVEEVKKLCNSC
RKYAKSERVLFHYNGHGVPKPTANGEIWLFNKSYTQYIPLPISDLDSWLKTPSIYVFDCS
AAGMIVNAFIELHDWNASVSSGSARDCILLAACEAHETLPQSAEFPADVFTSCLTTPIKM
ALRWFCTRSLLRESLDYSLIDKIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPHDLFQR
LFRQDLLVASLFRNFLLAERIMRSANCSPISHPMLPPTHQHHMWDAWDMAAEICLSQLKS
LVDDPNAEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFRALVLLG
RFLDMGPWAVDLALSVGIFPYVLKLLQTTTPELRQILVFIWTKILALDKSCQVDLVKDGG
HIYFIRFLDSVEAYPEQRAMAAFVLAVIVDGHKRGQEACIRAGLIDVCLKHLQGSIPNDG
QTEPLFLQWLCLCLGKLWEDFTDTQIIGLQAGAPAIYAPLLSLLSEPQPEVRASAVFALG
TLLDVGFDSTREGTGDEDCDDDDEKIKAEISVIKSLLNVVSDGSPLVRAEVAVALGRFAF
GHNKHLKSIAAAYWKPQSNLLNSLPSLAHAKGTTNVYTNPNQYMPYGSIVPPVGPLLRVG
NDNSVTRDGRVSTSSSPLANTGIMHGSPLSDDSSQLSDSGILNDGVSNGIVNHSRPKPLD
NAIYSQCVLAMRALAKDPSPRIASLGRRVLSIIGIEQVVNKPVKSAGTSVRPAEPTLLSP
TPSLIGLARSTSWFDMNGGNLPMTFRTPPVSPPRPSYLTGMRRVYSLEFRPHQLNSPDTG
LADPLLGSAGSSGVSERSFLPQSIIYNWSCGHFSKPLLSAADDNEEILARREEREKFALD
HISKCQHSSVSKLNNQIASWDTRFEAGAKTALLQPFSPIVVAADENERIRIWNYDEATLL
NSFDNHNFPDKGISKLCLVNELDDSLLLVASCDGNVRIWKDYTLRGQQKLVTAFSSIQGH
RPGVRSVNAVVDWQQQSGYLYAAGEISSIMAWDLDKEQLVYSIPSLSDSSISALSASQVH
GGQLAAGFVDGSVKLFDVRTPEMLVCAARPHTQRVERVVGIGFQPGLDPAKIVSASQAGD
IQFLDVRNGNCAYLTIDAHRGSLTALAIHRHAPLIASGSAKQIIKVFNLEGSQLGTIRFY
PTFMAQKIGSVNCLTFHPYQVLLAAGAADALVSIYADDNSQAR
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggagatttgatggcctcccgattttcgcaatcttcggtggccgtttcgaac
cacttggacgagtgttccagccacgaagatggggatttgaattcaaataggagggatagg
gattctgatgctgctagtagtagttatactaatgccactgcgaccactagtatggcctat
tttcctcagaatattgtgctttgcgagctccggcacgaggcgttcgaggcttgtgcgcca
tccggtccgtccgatagcggattggtctcgaaatggcggcctaaagaccgaatgaagaca
ggatgtgtagctcttgttttatgtttaaacattagtgttgatccacctgatgtaattaag
atatctccttgtgccagaatggagtgctggatagatccattttctatggctcctcaaaga
gcactggagatgattggaaaaaacttgagtgctcagtatgaaaggtggcaacccaaggcc
cgctgtaagtatcaactagatcctactgtggaggaagtgaagaaactttgtaattcgtgt
cgtaaatatgccaagtctgagagagttttgtttcactataatggacatggtgtaccaaag
ccgactgctaatggtgaaatttggcttttcaataagagctatactcagtatatccccttg
ccaatcagcgacctggattcctggttgaagacaccgtcaatatatgtttttgattgctct
gctgctgggatgattgtcaatgccttcatagagctccacgattggaatgcttctgtttcc
tctggatctgcaagggattgcattctgcttgcagcctgtgaagcacatgaaactcttcct
cagagtgctgaatttcctgctgatgtgttcacatcttgtctcactacacctatcaagatg
gcattgagatggttctgtacacgttcgttacttcgtgaatcccttgattattcactgata
gataaaattcctggccgccaaaatgaccgcaaaacacttttgggagaactgaactggatc
tttacagcagtgactgacaccattgcttggaatgttcttccccatgatctttttcagaga
ttgttcaggcaagacctgttagttgccagtctgtttcgaaatttcttacttgctgagaga
attatgcgatctgcaaactgttcccctatttcacaccccatgttgcccccaactcatcag
catcatatgtgggatgcatgggacatggctgctgaaatctgcctttctcagcttaagtca
ttggttgatgatcccaatgcagagtttcagccaagtcctttcttcactgagcagctgact
gcttttgaggtatggctagatcatggatcagaacacaagaaaccaccagagcagttgcca
attgttcttcaggttttactgagtcaatgccatcgatttcgagcgctggtgcttcttgga
agattccttgatatgggaccatgggctgtagatctggccctgtccgttggaatatttcca
tatgttctgaagctgttgcaaacaacaactccagaattaagacaaattcttgtatttata
tggacaaagatccttgcacttgataagtcatgtcaggttgatctggtaaaggatggtggc
cacatatatttcatcaggtttcttgacagtgtggaagcatatcctgaacagcgtgcaatg
gctgcatttgttttggctgtcattgtggatgggcataagcggggtcaggaagcctgtatt
cgagctggtttgatagatgtgtgcttaaagcaccttcagggttcaattccaaatgatggg
caaactgaacctctatttcttcagtggctttgtctctgtcttggaaagctgtgggaggac
ttcacagacacacaaatcataggtttgcaggcaggtgccccagctatatacgcacctcta
ttatcactattatctgagccccagcctgaggttagggcatcagctgtatttgcattaggt
accttgcttgatgttggatttgactcaacccgagagggtactggagatgaagactgtgat
gatgatgatgaaaagattaaggctgaaattagtgttattaaaagccttttaaatgttgtt
tcagatggatccccactggtcagggcagaggttgctgtagctctcggacgctttgccttt
ggccacaacaagcacctgaagtcgattgctgctgcatattggaaacctcagtcaaacctg
ctgaattctttaccatcgttggctcatgccaaaggtactactaatgtatatactaatcca
aaccaatacatgccatatggaagtattgttcctccagttggtcctctgttgagggttggc
aatgacaactcggtaactcgagatggaagggtctccactagcagcagccctcttgctaat
acaggaataatgcatggatctccattgtctgatgattcatctcaactttctgattctggg
atattaaatgatggtgttagcaatgggattgttaaccattcaaggcctaaaccactagac
aatgctatttattcacaatgtgtattggctatgcgtgctttagctaaagatccttcacca
cgtattgccagccttggtcggcgagttctttctattattgggatagaacaagtggtgaat
aaacctgtgaagtctgctggtactagtgttcgacctgctgaacccacactattatcccca
actcctagtcttattggactagctcgttcaacttcatggtttgacatgaatggaggtaat
ttgcctatgacctttagaacccctcctgttagtcctcctcggccaagttacttaacagga
atgcggagggtttattctttagagttcaggccacaccagctgaattctccagacacagga
ttagctgatccacttttgggttcagctggatcttctggggtttctgagcgcagttttctt
ccacaatcaattatctataattggagttgtggccacttctcaaaaccacttctctctgca
gcagatgataatgaagaaatattagctagaagagaagaaagggaaaaatttgcattggat
cacatctcaaaatgccagcactcatctgtaagcaagctgaataatcaaattgctagctgg
gatacaagatttgaggcaggggcaaaaacagctttgctgcaacctttttctcctattgta
gttgctgcagacgagaatgaacggatcaggatttggaattatgatgaagctacccttctc
aacagctttgacaatcataattttcctgataaaggaatttctaaactctgccttgtgaac
gagcttgatgacagcttgctgcttgttgcctcatgtgatggaaatgttcggatttggaaa
gattacacacttaggggtcaacagaaacttgtaactgcattctcttcaatccaaggtcat
agacctggtgtaagaagtgtgaatgctgttgtggactggcaacagcaatctggatatctg
tatgctgctggcgagatatcatccatcatggcttgggatctggataaggagcagcttgtt
tattcaattccttcattatcggattccagcatctcagcactgtctgcatctcaagttcat
gggggtcaacttgcagctggttttgtggatggttctgtcaagctatttgatgtccgaacc
cctgaaatgcttgtttgtgcagcacggccacacactcagagggtagaaagagtagtggga
attggctttcagcccgggctggatcctgcgaagattgtgagtgcatctcaggctggtgac
attcagttccttgatgtgagaaatggcaattgtgcctacctcacaattgatgctcacagg
ggctctcttactgctttggctattcatcgacatgccccgcttattgccagtggttcagca
aaacagatcatcaaagtctttaacctggagggttcacaattaggcaccatccgattctac
ccaaccttcatggcccagaagattggatctgtgaattgcctcacatttcatccatatcag
gtgctacttgctgctggtgctgcagatgctcttgtctctatctatgctgatgacaactct
caagcacgatga

DBGET integrated database retrieval system