KEGG   Vitis vinifera (wine grape): 100261998Help
Entry
100261998         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 553 aa AA seqDB search
MHKMSDSKLLLFGSFTEDETRSLLRLPSGNAEKPAAKKELQFGSVDFVTGRALASVGNEL
CRQADSSKGPIDFCSSNLLKKDDETKSVDGVNKLSSEAAGTPKENGGVHDFTHSSPLGNG
VVNELNPDRFNLDSLCLSQNKEHLNQFQSLESHVVEEECSKERDLNGTIDDSSTFVPLKK
EILKAPNGPAPAVKNLLPRGLINSGNLCFLNATLQALLSCTPFIQLLQELRIRDIPKVGY
PTLTAFAEFVSEFDMPTDLSLKKKDLNGVETGRPFSPAMFEGVLKNFTPDVPNKISGRPR
QEDAQEFLSFVMDQMHDELLKLEGFFSNLNGGKSSLVSSAEDDEWETVGPKNKSAVTRTQ
SFVPSELSKIFGGQLRSVVKARGNKASATVQPFLLLHLDILPEAIYTIEDALRLFSAPET
LEGYRTSGTGKAGLVTASKSVKIQKLSEIMILHLMRFYYDENQGSTKLHKPVTFPLELVL
GRELLVSPTTEGRKYELVATITHHGRDPSKGHYTTDARHHSGHWLRFDDSAVNVVSTSKV
LHEHPYVLFYKQV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaatgagtgattctaagttactactgtttggttcatttactgaagatgaaacc
aggtcattgctaaggctgccatctgggaatgctgaaaagcctgcagcaaagaaagagttg
caatttggttcagttgattttgtgactggtagagctttggctagtgttggcaatgaattg
tgcagacaggctgattcttcaaaagggccaatagatttctgttcctcaaatttgcttaag
aaggatgacgaaaccaaaagtgtagatggagtaaataaactctcttcagaagccgctgga
actcctaaagaaaatggtggagttcacgattttacacacagctctccactcggtaatggt
gttgtgaatgaactgaacccagataggttcaacttagattctttgtgtctatcccagaat
aaagaacatctgaatcaatttcagagtctggaatcgcatgttgttgaggaagaatgctca
aaggaaagagatctgaatgggactattgatgattcatcaacatttgtgcctctcaaaaag
gagatcttgaaggcacctaatggacctgctccagctgttaaaaacttactgcctcggggt
ttaattaactcgggaaacttatgctttctcaatgcaactttacaggcacttttatcatgt
actccttttattcagctattgcaggaactaaggattcgcgacatccccaaggttggctat
ccgacattaactgcatttgcagagtttgtctctgaatttgacatgcccactgatttgagt
ttaaagaagaaggatttgaatggcgttgagactggaaggcctttcagccctgctatgttc
gaaggtgttcttaaaaattttaccccagatgtgccaaataagatatcaggcaggccaagg
caggaagatgctcaggagtttttaagctttgtcatggatcaaatgcacgatgaattactt
aaacttgaagggttcttttcaaatttaaatggggggaaatcatcactagtttcttctgca
gaagatgatgaatgggagacagttggcccaaagaacaaatctgcagtgacaagaacacag
agttttgttccttcagaactaagtaaaatttttggaggacaattgagaagtgttgtgaag
gcaagaggaaacaaagcttctgcaactgttcagccatttctcctgctccacctcgatatt
cttcctgaggctatctatactattgaggatgcacttcgcttgttttctgcgccggagact
cttgagggttaccgaacatcaggaactggcaaggctgggcttgtgactgccagcaaatct
gtaaagattcagaaactttccgagataatgatattgcacctgatgcgattttattatgat
gaaaaccaaggcagtaccaagttgcataagcctgtgacctttcctcttgaattggtcttg
ggccgtgaattgcttgtctctccaactactgagggccgaaagtatgaactcgttgccaca
attactcaccatgggagagatccttcgaaggggcattataccactgatgctcgtcaccat
agtgggcactggctaaggtttgatgattcagctgtcaatgtcgttagcacaagcaaggtg
ttgcatgagcacccttatgtcctcttctacaagcaagtatag

DBGET integrated database retrieval system