KEGG   Vitis vinifera (wine grape): 100262152Help
Entry
100262152         CDS       T01084                                 

Definition
protein-L-isoaspartate O-methyltransferase 1
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100262152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 293 aa AA seqDB search
MLSPLVLAYTCRYCAPLNHLLTFTLHQHHHHRHSLAISAPSTTLSCLHTPNPRFLTGNSL
VFKMERFFSGSGINKNKAMVEHLQRYGVINSKKVAQVMETVDRALFVPDGNPPYVDSPMQ
IGYNATISAPHMHATCLELLQENLQPGMHALDVGSGTGYLTACFALMVGPQGCAVGVEHI
PELVASSIKNIEKSAAAPLLKEGSLKLHAGDGRLGWPECAPYDAIHVGAAAPEIPQPLID
QLKPGGRMVIPVGNIFQDLKVVDKNLDGSISIRSETSVRYVPLTSREAQLRDY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctatctcctcttgtgttagcttacacttgccgctattgtgcgccgcttaaccacctc
ttaaccttcaccctccaccagcatcaccaccaccggcactccctcgccatctctgcgccc
tcgaccactctatcttgtctgcataccccaaatcctaggttcctaacggggaactctctc
gttttcaagatggagcgattcttttctggaagtgggatcaataagaataaagcaatggtg
gagcacttgcagcgctatggagtgattaattcgaaaaaggtagctcaagtaatggagact
gttgacagagcattgtttgtgcctgatgggaacccaccttatgttgacagccccatgcag
ataggttacaatgccactatttcagcacctcatatgcatgccacatgcctcgagctgttg
caggaaaatttgcagcctggaatgcatgctctagatgttggttctggaacggggtatttg
acagcctgctttgcactgatggttggaccacaaggttgtgcagttggagtagaacacata
cctgagttggttgcttcttcaatcaagaatatcgaaaagagtgcagcggctccgttatta
aaagaaggttctctcaaactgcatgccggtgatggaaggctaggttggcctgagtgtgca
ccatatgatgcaattcacgtcggagccgcagcacctgagataccacagccacttattgat
cagttgaagcccggtggtagaatggtcattcctgttgggaacatattccaggatttgaag
gtagtggacaagaacctggacggctccatcagtatccgcagcgagacttctgtccgctat
gttccactgacaagtcgggaggctcagttgcgcgattattga

DBGET integrated database retrieval system