KEGG   Vitis vinifera (wine grape): 100262414Help
Entry
100262414         CDS       T01084                                 

Definition
eukaryotic translation initiation factor 4E-1-like
Orthology
K03259  
translation initiation factor 4E
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:vvi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 236 aa AA seqDB search
MGDTVVEELPRSATTEDQGSTHNPNPRPHGDDEEDLEEGEIVVDDASASLKQSAAITHQP
HPLEHSWTFWFDNPSAKSKQAAWGSSMRPIYTFSNVEEFWSIYNNIHHPSKLAVGADFHC
FKHKIEPKWEDPVCANGGKWTVTFAKGKSDTCWLYTLLAMIGEQFDHGDEICGAVINVRA
RQEKIALWTKNASNEAAQLSIGKQWKEFLDYSESIGFIFHEDAKKLDRAAKNRYTI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggagatacggttgtagaggagctaccgaggtctgccaccacggaggatcagggttcc
acccacaaccctaaccctaggcctcatggcgacgatgaagaggacctcgaggagggagag
atcgttgtcgatgacgcctcggcgtcactgaagcagtcggcggcgataacccatcaacct
cacccgctggagcattcgtggactttctggtttgacaaccccagcgctaaatcgaagcaa
gccgcatggggcagttcgatgcgcccgatctacactttctctaacgttgaagagttctgg
agcatttacaacaatatacatcatccgagcaagttagctgtcggagcagacttccattgt
ttcaaacacaaaattgagccaaaatgggaggaccctgtttgtgctaatggggggaagtgg
actgtaacctttgctaaagggaaatctgatacctgttggctttatacgttgctagccatg
atcggagaacagtttgatcatggagatgaaatctgtggagcagtgatcaatgtcagagct
agacaggagaaaatagctctatggaccaagaatgcttcaaatgaagctgctcagctgagc
attggaaaacaatggaaggaatttctggattacagcgaaagcataggcttcatatttcat
gaggatgcaaagaagcttgacagagctgccaagaatcgatacacgatatga

DBGET integrated database retrieval system