KEGG   Vitis vinifera (wine grape): 100262551Help
Entry
100262551         CDS       T01084                                 

Definition
transketolase, chloroplastic-like
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100262551
   01230 Biosynthesis of amino acids
    100262551
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100262551
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100262551
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    100262551
Enzymes [BR:vvi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     100262551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 745 aa AA seqDB search
MASSSSLSISQAIVAGALNHRGSTNSSDRLPLRSFTIPTFSGLKSTTSAASCPSRLGSAR
RRLCRRLAVQAASVETLEKTETTLIEKSVNTIRFLAVDSVEKANSGHPGLPMGCAPMGHV
LYDEFMKFNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSTTP
GHPENFETPGVEVTTGPLGQGIANAVGLALAERHLAARFNKPDNEIVDHYTYVILGDGCQ
MEGVAHEACSLAGHWGLGKLIALYDDNHISIDGDTEIAFTENVDLRFEALGWHVIWVKNG
NTGYDEIRAAIKEAKTVKDKPTLIKVTTTIGYGSPNKSNSYSVHGSALGPKELDATRKNL
RWPYEPFHVPEDVKKHWSRHVPEGAALEAEWNAQFAEYERKYKEEAAVLKSLINGELPAG
WEKALPTYTPESPAEATRNSSQQCLNALANVLPGLLGGSADLASSNLSVMKQFGNFQKGT
PEERNVRFGVREHGMGAICNGIVLHCPGLIPYCATFFVFTDYLRPAMRISALCEAGVIYV
MTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGTETAAAYKIAVLNRKRPSVLAL
GRRDVSQLRGTSIEGVEKGGYIVTDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAV
RVVSLVCWALFDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRFGAS
APALKLYKELGVTAEAVIAAAKSIC
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgtcttctctctccatttctcaagccattgtcgccggagccctcaaccac
cgcggctccactaattcctctgatcgcctacccctgcggtcattcactattcccaccttc
tccggcctcaaatccaccacctcagctgcttcatgcccttctcgcctcggctcagctcgg
cggaggctgtgccggagattggcggtgcaggctgcttcggtggagaccttggagaagacg
gaaactaccttgatcgagaaatcggtgaacaccatccggtttctggccgtcgattcggtg
gagaaggcgaactcgggtcacccgggtttgccaatgggttgtgctccaatgggccatgtt
ttatacgatgagttcatgaagtttaaccccaagaacccctactggttcaatcgtgatcgc
tttgttctctctgccggacatggatgcatgcttcagtacgctctgcttcaccttgctggc
tacgacagtgtcagggaagaagacttgaaaagtttccgtcaatggggaagcacaacacct
ggtcacccagaaaattttgagacacctggtgttgaagtcactactggtcctcttggtcag
ggtattgccaatgctgttggcttggctcttgcggagaggcacttggctgctcgattcaac
aaaccagacaatgagattgttgatcactacacatacgtgatactgggggatggttgtcaa
atggagggtgttgcacatgaagcttgttcacttgctggacattggggtcttgggaagctg
atagctttgtatgatgataaccacatctctattgatggtgacactgagattgctttcacg
gagaatgttgacttacgttttgaggctcttggttggcatgttatctgggtgaagaatgga
aatactggctatgatgagattcgtgctgccatcaaggaagcaaagactgtcaaagacaaa
cccactttaatcaaggtgactacaaccattggttatggatccccaaacaagtcaaactca
tacagtgtacatggaagtgcactaggtcctaaggagttggatgccacaaggaagaacctt
cgatggccatatgagcctttccatgtacccgaggatgtcaagaagcattggagccgccat
gtccctgaaggtgcagctctggaagctgaatggaatgcccagtttgctgaatacgaacgc
aagtataaagaagaagctgcagtattgaagtctctcatcaatggtgaattacctgcaggt
tgggagaaggcacttccgacgtatactccagagagcccagcagaagccacgagaaattca
tcacaacaatgtctaaatgcccttgcaaatgttctccctggtctgcttggtggcagtgct
gatcttgcttcctccaacctgtcggtgatgaagcagtttgggaacttccaaaagggcaca
ccagaagagcgcaatgtcaggtttggtgttcgggagcatggaatgggagccatctgcaat
gggattgtccttcactgccccggccttattccatattgtgcaactttctttgttttcact
gactacttgagacctgccatgaggatttctgccttgtgtgaagctggagtcatctatgtt
atgacacacgattcaattgggcttggagaagatggacctacacatcagcctatagagcac
ttggcaagttttcgggctatgcccaacattttgatgcttcgccctgctgatgggactgag
acagctgcagcttacaagattgcagtccttaacaggaagagaccctcagtccttgccctt
ggtcggcgagatgtctcccagcttcgtggaacatccattgagggagttgagaagggaggt
tacatcgtaacagacaactcttcaggcaacaaaccagatgttatattgattggaactggt
tcggaattggaaattgctgccaaagcagctgatgaactcagaaaggaagggaaagctgtc
agggttgtttccttggtttgctgggcgctttttgatgaacaatcagatgcttacaaggaa
agtgttttgccagcagctgtatcagcccgggtcagcgttgaagctgcatcaacatttggg
tgggagaagtttgttgggagcaaagggaagtcaattggtattgatcggtttggggcaagt
gcacctgcactaaagttgtacaaggagcttggcgtaacagcagaggctgttatagcggca
gctaaatcaatttgctag

DBGET integrated database retrieval system