KEGG   Vitis vinifera (wine grape): 100262551Help
Entry
100262551         CDS       T01084                                 

Definition
transketolase, chloroplastic-like
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:vvi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvi01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vvi00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:vvi00710]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 745 aa AA seqDB search
MASSSSLSISQAIVAGALNHRGSTNSSDRLPLRSFTIPTFSGLKSTTSAASCPSRLGSAR
RRLCRRLAVQAASVETLEKTETTLIEKSVNTIRFLAVDSVEKANSGHPGLPMGCAPMGHV
LYDEFMKFNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVREEDLKSFRQWGSTTP
GHPENFETPGVEVTTGPLGQGIANAVGLALAERHLAARFNKPDNEIVDHYTYVILGDGCQ
MEGVAHEACSLAGHWGLGKLIALYDDNHISIDGDTEIAFTENVDLRFEALGWHVIWVKNG
NTGYDEIRAAIKEAKTVKDKPTLIKVTTTIGYGSPNKSNSYSVHGSALGPKELDATRKNL
RWPYEPFHVPEDVKKHWSRHVPEGAALEAEWNAQFAEYERKYKEEAAVLKSLINGELPAG
WEKALPTYTPESPAEATRNSSQQCLNALANVLPGLLGGSADLASSNLSVMKQFGNFQKGT
PEERNVRFGVREHGMGAICNGIVLHCPGLIPYCATFFVFTDYLRPAMRISALCEAGVIYV
MTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGTETAAAYKIAVLNRKRPSVLAL
GRRDVSQLRGTSIEGVEKGGYIVTDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAV
RVVSLVCWALFDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRFGAS
APALKLYKELGVTAEAVIAAAKSIC
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgtcttctctctccatttctcaagccattgtcgccggagccctcaaccac
cgcggctccactaattcctctgatcgcctacccctgcggtcattcactattcccaccttc
tccggcctcaaatccaccacctcagctgcttcatgcccttctcgcctcggctcagctcgg
cggaggctgtgccggagattggcggtgcaggctgcttcggtggagaccttggagaagacg
gaaactaccttgatcgagaaatcggtgaacaccatccggtttctggccgtcgattcggtg
gagaaggcgaactcgggtcacccgggtttgccaatgggttgtgctccaatgggccatgtt
ttatacgatgagttcatgaagtttaaccccaagaacccctactggttcaatcgtgatcgc
tttgttctctctgccggacatggatgcatgcttcagtacgctctgcttcaccttgctggc
tacgacagtgtcagggaagaagacttgaaaagtttccgtcaatggggaagcacaacacct
ggtcacccagaaaattttgagacacctggtgttgaagtcactactggtcctcttggtcag
ggtattgccaatgctgttggcttggctcttgcggagaggcacttggctgctcgattcaac
aaaccagacaatgagattgttgatcactacacatacgtgatactgggggatggttgtcaa
atggagggtgttgcacatgaagcttgttcacttgctggacattggggtcttgggaagctg
atagctttgtatgatgataaccacatctctattgatggtgacactgagattgctttcacg
gagaatgttgacttacgttttgaggctcttggttggcatgttatctgggtgaagaatgga
aatactggctatgatgagattcgtgctgccatcaaggaagcaaagactgtcaaagacaaa
cccactttaatcaaggtgactacaaccattggttatggatccccaaacaagtcaaactca
tacagtgtacatggaagtgcactaggtcctaaggagttggatgccacaaggaagaacctt
cgatggccatatgagcctttccatgtacccgaggatgtcaagaagcattggagccgccat
gtccctgaaggtgcagctctggaagctgaatggaatgcccagtttgctgaatacgaacgc
aagtataaagaagaagctgcagtattgaagtctctcatcaatggtgaattacctgcaggt
tgggagaaggcacttccgacgtatactccagagagcccagcagaagccacgagaaattca
tcacaacaatgtctaaatgcccttgcaaatgttctccctggtctgcttggtggcagtgct
gatcttgcttcctccaacctgtcggtgatgaagcagtttgggaacttccaaaagggcaca
ccagaagagcgcaatgtcaggtttggtgttcgggagcatggaatgggagccatctgcaat
gggattgtccttcactgccccggccttattccatattgtgcaactttctttgttttcact
gactacttgagacctgccatgaggatttctgccttgtgtgaagctggagtcatctatgtt
atgacacacgattcaattgggcttggagaagatggacctacacatcagcctatagagcac
ttggcaagttttcgggctatgcccaacattttgatgcttcgccctgctgatgggactgag
acagctgcagcttacaagattgcagtccttaacaggaagagaccctcagtccttgccctt
ggtcggcgagatgtctcccagcttcgtggaacatccattgagggagttgagaagggaggt
tacatcgtaacagacaactcttcaggcaacaaaccagatgttatattgattggaactggt
tcggaattggaaattgctgccaaagcagctgatgaactcagaaaggaagggaaagctgtc
agggttgtttccttggtttgctgggcgctttttgatgaacaatcagatgcttacaaggaa
agtgttttgccagcagctgtatcagcccgggtcagcgttgaagctgcatcaacatttggg
tgggagaagtttgttgggagcaaagggaagtcaattggtattgatcggtttggggcaagt
gcacctgcactaaagttgtacaaggagcttggcgtaacagcagaggctgttatagcggca
gctaaatcaatttgctag

DBGET integrated database retrieval system