KEGG   Vitis vinifera (wine grape): 100262564Help
Entry
100262564         CDS       T01084                                 

Definition
(RefSeq) lecithin-cholesterol acyltransferase-like 1
  KO
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100262564
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100262564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
18
AA seq 433 aa AA seqDB search
MEMKGLGLIMGMVSMAVMWYECQASSNLHPLILVPGSGGNQLEARLTDGYKPSSLLCSRS
YPPFKDKEGWFRLWFRPALLVSPFTQCFADRMTLYYDPQLDDYVNTPGVETRVPSFGSTR
SLLYLDPHLKRVTAYMGALVKALEHMGYVDGKTLFGAPYDFRYGLAADGHPSRVGSKFLE
DLKDLIEKASTSNGGKPVILVSHSLGGLFVLQLLNRNPPSWRQKFIKHFVALATPWGGAV
QEVHNLASGYTLGAPLVDPLLVRGQQRSSESNLWLIPSPKVFGAQPFAVTLNATYTANDV
VQFLNDIGFSGGIHPYQSRIVPLLERLPAPAVPVTCIFGSGVKTAETLFYDESGFDKQPE
IVYGDGDGTVNMVSLEALQLEWADQQNQPLKTIRIEGASHISIFQDEKAVNRIVKEISGI
NSDIHHVKSLIDQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaagggattgggattaataatgggcatggtttcgatggccgtgatgtggtac
gaatgtcaggcaagcagcaatctccaccctctgatcctggtgccagggagtggtggaaat
cagctagaagcaaggcttacggatggatacaaaccgtccagcttgctgtgcagccgaagc
tatccgcctttcaaggacaaggaagggtggttcaggctgtggttccgccccgccctgctc
gtctctccattcacccaatgctttgccgaccgcatgacgctttactatgacccacagctt
gatgattatgtaaatacccctggggtcgaaaccagggtccctagctttggttctactcgc
tccctcctgtatcttgatcctcatctcaagcgcgtcacagcatacatgggggccctggtg
aaagctctggagcatatgggttacgttgatggcaaaacattattcggagctccatatgat
tttcgatacggtttagcagcagatggtcacccatcacgtgtgggttccaagttccttgag
gacctcaaagatttgatagaaaaagcaagcacttctaatggaggaaaaccagtaatcctc
gtctcccacagcttgggaggcctgtttgtcctccaacttctcaaccgaaaccccccatct
tggcgccagaaatttatcaagcacttcgttgcactggccactccttggggcggcgcagtg
caggaagtgcacaaccttgcttctggctacacactgggagcacccctagttgatccattg
ctggtgagggggcagcagaggagctcagagagcaacttatggctcattccttctcctaaa
gtgtttggtgcgcaaccatttgcggtcacattaaatgctacttatacagcaaatgatgtt
gtgcagttcctcaatgacattgggttttcgggaggaatccatccttaccaatctcgcatt
gtgcctttgttggaacggttaccagcgcctgcggtgcctgtcacctgtatattcgggagt
ggtgttaaaacagcagaaacactgttctatgatgaaagtggttttgataagcaaccggag
attgtttatggggatggagatgggacagtgaacatggtaagcttggaagctcttcaattg
gagtgggctgatcagcaaaatcaaccccttaagactattagaatcgaaggggcttctcat
atttcaatattccaagacgaaaaagcagttaatagaatagtaaaagaaatttcaggtatt
aattctgatattcatcatgtaaagagcctaattgatcagtga

DBGET integrated database retrieval system