KEGG   Vitis vinifera (wine grape): 100262634Help
Entry
100262634         CDS       T01084                                 

Definition
uncharacterized LOC100262634
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100262634
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100262634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 845 aa AA seqDB search
MDGEANLPAPSASANNLSRPILPDSYQNRSITSSSSSSSSSSSFYSSSPPDFLRHVQAAF
KRHRPLGTMQSNSIMPRRILVPRRETSKITASNVVPTIDAKKSQDVRPSMHQGNTGKELV
VEIRNKVSVVGETEEDAPITPPSISGSITNEDLYDVQRVQCKPVAGCKNTDGVSFSHVES
QHVPVVDGQKKVQFLLGKNASSQEMEWDVSNQVEAPTDVNHDLKHGYFQNLESDVTSRSD
GGISSLLAKKPVLAQDQLHRFRNFLQSDINHPMTQASVAGSSCATTISVHATSAPVINST
TYCSSSHQDISPHLAVETLGDVNLNSQPISKGDVMQPSHPPSKSTSGVIVDRTAIAAQAS
SSSIDTQSKVKEYGFSEQQDRVPNERDIPKNPSPLDDNSTKGKGFTGDVTDLQSQVPLSK
SSSSDVKLETSKSEKQEKVVSGKGSSVPRKKNYDPDMFLKVNGKLYQRLGKIGSGGSSEV
HKVISSDCSIYALKKIRLKGRDYATAYGFCQEIQYLNKLKGKSNIIQLIDYEVTDKTLLQ
EVMNGSMSNKDSRVKDDGCIYMVLEYGEIDLANMLSQKWKEMDSSDRTIDENWLRFYWQQ
ILQAVNTIHEERIVHSDLKPANFLLVKGSLKLIDFGIAKAIMSDTTNIQRDSQVGTLSYM
SPEAFMCNESDANGNTIKCGRPSDIWSLGCILYQMVYGRTPFSEFKTFWAKFKVITDRNH
EIKYEPVSNPWLLDIMKKCLAWDRNERWRIPELLQHPFLVPPVPVLAQLSSSQDQSCKLL
QLITEACANDPKALILCRQLQQLLRDPVTVPTSQVLTSRDQQCKLLSYVSKLCCQLQEYL
SDPDT
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggacggggaggctaaccttccggccccatctgcgtctgccaataatctcagccgtccg
atcctgcctgactcctatcagaaccgttcgatcacctcgtcgtcatcgtcatcatcatcg
tcatcatcgttctattcatcttctccgccggactttctccggcatgtccaggctgccttc
aagcgccaccgtccactcggtacaatgcagtctaatagtattatgccaaggcgtatattg
gttccccggcgagaaacctcaaagatcactgcatcaaatgtggttcccacaatagatgcc
aaaaaatctcaggatgtgcgtccttcaatgcatcagggtaacacagggaaagagttggtt
gtggagataaggaacaaggtatctgttgttggggaaactgaagaagatgcaccaattact
ccaccttcaatttcaggcagtatcactaatgaagatctatatgatgtgcaacgagtgcaa
tgcaaacccgttgctggatgcaaaaatactgatggggtttcattttcacatgtagaatct
cagcatgttccagttgttgatggtcagaagaaggtccagtttttgttggggaaaaatgct
agctcacaggaaatggaatgggatgtgagcaatcaagtagaggcaccaactgatgtcaat
catgacttgaagcatgggtattttcagaacctggaatcagatgttacttcgaggtctgat
ggtgggatttcttctttattggcaaagaaacctgtacttgctcaggatcagctgcaccga
ttcagaaacttcttgcagagtgacataaaccaccccatgactcaagcttcagtggctgga
tcatcatgtgctactacaatatctgttcatgcaacttctgcaccagtgatcaattcaaca
acctactgctcctcttcacatcaagatattagtcctcacctggcagtagaaactctggga
gatgttaatcttaattctcaacctataagtaaaggagatgttatgcagccatcgcatcct
ccatctaagtccaccagtggagtcatagttgaccgcacagcaattgcagcccaagcttca
tcttcttccatagatacccagtcgaaagttaaggaatatggctttagtgagcaacaagac
agagtgccaaatgaaagggacattccaaagaatccttctcctcttgatgataattcaact
aaaggaaaaggattcactggtgatgttactgatttacaatctcaggtgcccttatccaaa
agttcatcatcagatgtgaaattggagacctctaaatctgaaaaacaagaaaaggttgta
agtggtaaagggtcatcagtgcctcgcaaaaagaattatgatcctgacatgtttttgaaa
gttaatggtaagctctatcaaaggcttggtaagataggtagtggaggaagcagtgaagtc
cacaaagttatatcatcagattgttctatctatgcccttaaaaaaatcaggcttaaaggt
cgtgattatgctactgcatatgggttctgtcaagagattcaatatttaaacaagttgaaa
gggaagagcaacatcatacaacttattgactatgaggtgacagataagacattgctccaa
gaagtcatgaatggctccatgagtaataaagatagcagagtcaaggatgatggatgcata
tacatggtgcttgaatatggggaaattgatttggctaacatgctgtcccagaaatggaag
gaaatggatagctctgatcggaccatagatgagaattggcttcgattttactggcagcaa
atacttcaagctgtcaataccatacatgaagagcgtatagtgcattcagacttgaagcca
gcgaattttcttcttgtcaaaggttccttgaagctgatcgattttggaattgctaaagct
ataatgagtgatacaaccaacattcaaagggattcacaggtgggtacactgagctacatg
tctcctgaagcattcatgtgcaatgagagtgatgccaatggaaacactataaagtgtggt
cggccatcagatatctggtcacttggttgcatcctttaccaaatggtgtatggaagaacc
cccttttcagaattcaagacattctgggccaagttcaaagtcattacagatcgtaaccat
gaaataaagtatgagccagtctcaaacccatggcttcttgatattatgaagaagtgtctt
gcatgggaccgtaatgagaggtggaggattcctgagctacttcaacacccttttcttgtt
cccccagtcccagtcctagcccagttatcatcctctcaagaccaaagctgtaaactgctt
caactgattactgaagcttgtgccaatgacccgaaggctttgattttatgtcgtcaactt
caacaactactaagggacccagtcacggtgccaacatctcaagtactaacatcacgagac
caacagtgtaagttgctctcctatgtgtcaaagctttgctgtcaacttcaggaatattta
tcagaccccgatacgtaa

DBGET integrated database retrieval system