KEGG   Vitis vinifera (wine grape): 100263057Help
Entry
100263057         CDS       T01084                                 

Definition
uncharacterized LOC100263057
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100263057
   00240 Pyrimidine metabolism
    100263057
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100263057
   03410 Base excision repair
    100263057
   03420 Nucleotide excision repair
    100263057
   03430 Mismatch repair
    100263057
   03440 Homologous recombination
    100263057
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100263057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 122 aa AA seqDB search
MASGNMKGYFKQKKSGGGRGIAKPKPSKKSTKIQPTHVATLGSDVVQPSTLSAHNLQDDE
YDGNETVLRQFDMNMAYGPCLGMSRLARWERAQRLGLNPPKEIETLLKQGKARADCLWDG
CV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggcaacatgaagggttacttcaagcagaagaagagtggaggaggaagagga
atcgccaagccaaagccttccaagaaatccactaagatacagcctacccatgtcgccact
ttaggctctgatgtggtccaaccttcaaccctctcagcccataatctccaagatgatgaa
tatgatgggaatgagacggtgttgaggcagtttgacatgaacatggcatatggaccatgc
ctagggatgagcagactggcgcgatgggagcgtgctcagcgtctaggcctgaaccctccc
aaggagattgaaaccctcctgaaacaaggcaaggctcgggctgactgcttgtgggatggc
tgcgtttag

DBGET integrated database retrieval system