KEGG   Vitis vinifera (wine grape): 100263356Help
Entry
100263356         CDS       T01084                                 

Definition
(RefSeq) elongator complex protein 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100263356
Transfer RNA biogenesis [BR:vvi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100263356
Chromosome and associated proteins [BR:vvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100263356
   HAT complexes
    Elongator complex
     100263356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 100263356
NCBI-ProteinID: XP_002262701
UniProt: F6GSF4
Position
17
AA seq 563 aa AA seqDB search
MATAVVAESRKLPRPGRGGVVSHGLSEEEARVRAIAEIVNNMVELSHRGENVDLNALKSA
ACRKYGLSRAPKLVEMIAALPESERDSLLPRLRAKPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDK
VEFILMGGTFMSLPAEYRDYFTRNLHDALSGHTSANVEEAVAYSEHSAIKCIGMTIETRP
DYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAH
MMPDLPNVGVERDLESFREFFESPMFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTR
EAGIQDIHHKIKPEEVELVRRDYTANEGWETFLSYEDIRQDILVGLLRLRKCGRNTTCPE
LIGRCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEAAERIAGREHRSTKIAVISGV
GTRHYYRKLGYELEGPYMVKYLV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcggtggtggcggagtctcgaaagctgcctcggccgggtcgaggcggagtg
gtctcgcatggtctcagtgaagaagaggctcgagtcagagccatagccgagatcgtgaac
aacatggtggagctctctcacaggggcgaaaacgtcgacctcaacgccctcaaatccgcc
gcttgccgaaagtacggactctcccgcgcccccaaactcgtggagatgatcgcggcgttg
cccgagtcagaacgcgactcgctcctccctcgcctccgggccaagccggttcgaaccgcc
tcaggaatcgccgtggtcgccgtgatgtcgaagcctcacaggtgtccacatatcgcaacc
acggggaatatttgtgtttattgccctggaggacctgattctgattttgagtacagtaca
cagtcgtacactggatacgagcccaccagcatgcgcgcgattcgtgctagatataaccca
tatgtccaggctagaagcaggatcgatcagctgaagcggctgggtcatagtgtagacaag
gtagagttcattttaatgggtggtaccttcatgtcactgccagccgagtaccgtgattac
tttacaaggaatctacatgatgctttgtcaggacacacttctgccaatgttgaagaggct
gttgcctactcagagcatagtgcaataaagtgtattggaatgaccattgaaacgaggcca
gattactgtcttggacctcatttgcggcaaatgctttcttatggttgtacacggctggag
attggagttcaaagcacctacgaggatgttgcccgtgacactaatagaggacatacagta
gctgctgtggctgattgtttttgcttggccaaggatgctggtttcaaggttgttgctcat
atgatgcctgaccttccaaatgttggggtagagagggacttggaaagtttccgggagttt
tttgaaagccctatgtttagagctgatgggctcaaaatatatccaacacttgtaattcgt
ggaactgggctttatgagctttggaaaacgggcaggtataggaattacccacctgagcaa
cttgtagacattgtagcaagaattctagccatggtacccccttggactcgtgtttataga
gttcagagggatattcctatgcctctggttacttctggggttgagaaaggaaatctacgg
gagctagctttagctaggatggatgacttgggcttgaaatgccgtgatgttcggacacgt
gaagctggaatccaggacatccaccacaaaattaagccagaggaggttgagcttgttcgc
cgtgattatacagcaaatgaaggttgggaaacttttctttcatatgaggatatacgccag
gatattcttgttgggttgttgcgcttgcgcaaatgtgggcgaaacactacttgcccagag
ctgattggcagatgttcaattgttcgtgaactccatgtttatgggactgcagtcccagtc
catggacgggatgctgacaagcttcaacaccagggttatggtacacttctgatggaggcg
gcagaacggattgctgggagagagcacagatcaacaaaaatagcagttatttctggtgtt
ggaacgcgtcattactacaggaaactggggtatgagcttgaagggccgtacatggtgaaa
tatcttgtatga

DBGET integrated database retrieval system