KEGG   Vitis vinifera (wine grape): 100263369Help
Entry
100263369         CDS       T01084                                 

Definition
(RefSeq) histone H2B.3
  KO
K11252  histone H2B
Organism
vvi  Vitis vinifera (wine grape)
Brite
Chromosome and associated proteins [BR:vvi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100263369
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100263369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100263369
NCBI-ProteinID: XP_002264142
UniProt: F6HNA5
Position
13
AA seq 145 aa AA seqDB search
MAPKAEKKPAEKKPAGGEEKKAEKAPAEKKPRAEKKLPKDASSTDKKKKRTRKNVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcagagaagaagcccgcggagaagaagccagccggtggcgaggagaag
aaggccgagaaggctccggcggagaagaagccaagggctgagaagaagctaccaaaggac
gcgtcttctactgataagaagaagaagaggacgaggaaaaatgtggagacctataagatc
tacatcttcaaggtgttgaagcaggttcatcctgacatcgggatttccagcaaggctatg
ggcatcatgaacagcttcatcaatgacatctttgagaaactcgctcaggaggcctccagg
ctcgcgaggtacaacaagaagccgaccatcacctccagggagattcagaccgctgtgagg
cttgttctgcccggtgagcttgcgaagcacgctgtttctgaggggaccaaggcggtcacc
aagtttactagctcttag

DBGET integrated database retrieval system