KEGG   Vitis vinifera (wine grape): 100263458Help
Entry
100263458         CDS       T01084                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100263458
  Lipid metabolism
   00561 Glycerolipid metabolism
    100263458
   00600 Sphingolipid metabolism
    100263458
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100263458
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100263458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 404 aa AA seqDB search
MGGGATFFSVVVLLLVQCIGKGTRAANLSSNAHQDYTQFLLANGVARTPPMGWNSWNHFQ
CKIDESTVKATADALISTGLAALGYKYVNIDDCWGEGNRDSRGNLVARSSTFPSGIKALA
DYVHARGLKLGIYSDAGYSTCSKTMPGSFGHEDQDARTFAEWGVDYLKYDNCYNDGSKPQ
DRYARMSSALHKAGRPILYSLCEWGQENPATWASSIGNAWRTTGDIKDNWDSITSIADAN
NIWGRYAGPGRWNDPDMLEVGNGGMSLEEYRSHFSIWALMKAPLLIGCDVRSSSKETLSI
LGNKEVIDVNQDPLGIQGRKIHSKASVEVWAGPLSKRRVAVVLWNRGSSQAPITVGWREI
GLSPSNPVTVRDLWTHSFLSRSMRSRLTAYVAPHACKMYILTPL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaggagctacctttttctcagtcgttgttctacttctagttcaatgcatcggc
aaaggaacaagagctgcgaacctcagcagcaatgcccatcaggactacactcagttcctt
cttgcgaatggggttgctcgtacgcctccaatggggtggaacagctggaatcatttccaa
tgtaagattgacgagtcgactgtcaaagccacagctgatgctcttatttcaactggtttg
gccgcactcggatacaaatatgtgaatattgatgactgctggggagaggggaacagagac
tcgaggggtaatctggtagcaagatcttcaacttttccttctggaatcaaggctcttgca
gattatgttcatgcaagaggcttaaaacttggcatatactcagatgctggttacagcaca
tgcagtaagacaatgccaggctcttttgggcatgaggatcaagatgcaagaacatttgct
gagtggggggttgactacttgaagtatgataactgttataatgatggttccaagcctcag
gataggtatgcaaggatgagttctgcattacacaaggctggcagaccgatcctttactct
ctctgtgaatggggacaagagaatccagcaacatgggctagttcgatcggtaatgcatgg
aggactacaggggacattaaagacaactgggacagcataacatcaattgcagatgcaaac
aacatttggggaagatatgcagggcctggcaggtggaatgatcctgacatgttggaagtg
ggcaatggagggatgagtttagaagagtaccgctctcattttagcatttgggctcttatg
aaagctcctctactcattggatgtgatgtccgatcttcaagcaaagagactcttagtatc
cttggaaacaaggaggtgatagatgttaatcaggatccactgggaattcaaggaaggaaa
atacattccaaagccagcgtagaagtttgggctgggccattatcaaagagaagagtggcg
gtagtattatggaatagaggctcatctcaggctcccataacagtgggatggagggaaatt
ggtctatctccatctaatcctgtcacagtcagagacttgtggactcattcatttctttcg
agaagtatgcgttcccgattaacagcatatgttgctccccatgcttgtaagatgtatatc
ctcaccccactctaa

DBGET integrated database retrieval system