KEGG   Vitis vinifera (wine grape): 100263518Help
Entry
100263518         CDS       T01084                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vvi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vvi00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 708 aa AA seqDB search
MATSPASSSPQRKILKTSNHLRHVDSMSVKPSGAGKVSQLNAVILGEALASEAHDLVFPS
RDFSSQALVSSPEKYEEMYKRSVEDPAGFWSDIASDFYWKEKWSQPVCSENLDVRNGNIK
IEWFKGGRTNICYNCLDRNIESGNGGKVAIYWEGNEPGFDASLTYAQLLDKVCQLANYLK
DMGVRKGDAVVIYLPMLMELPIAMLACARIGAVHSVVFAGFSSESLAQRIVDCKPKVVIT
SNAVKRGPKVISLKDIVDAALVESAKNGISVDACLTYENQSAMKRETTKWQEGRDIWWQD
VVPKYPTTCDVEWVDAEDPLFLLYTSGSTGKPKGVLHTTGGYMIYTATTFKYAFDYKPSD
VYWCTADCGWITGHSYVTFGPMLNGATVIVFEGAPNYPDSGRCWDIVDKYKVTIFYTAPT
LVRSLMRDGDEYVTRYSRKSLRVLGSVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETG
GFMITPLPGAWPQKPGSATFPFFGVQPVIVDEKGIEIEGECNGYLCVKSSWPGAFRTLYG
DHDRYETTYFKAFPGYYFSGDGCSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALVSH
PKCAEAAVVGVEHEVKGQGIYAFVTLVEGVPYSEELRKSLIMTVRSQIGAFAAPDRIHWA
PGLPKTRSGKIMRRILRKIASRQLNELGDTSTLADPNVVDELIKLADS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtctccggcatcttcatcgccgcagcggaagattctcaagacctcgaatcac
ctccgccacgtggattcaatgtcggttaagccttccggcgctggcaaggtgtcgcagttg
aacgctgtcatactgggcgaagcgctcgcttccgaggcgcatgatctcgtctttcccagt
cgtgacttctcctcacaagctctcgtctcctctcccgaaaagtatgaggagatgtacaaa
aggtcagttgaggatccagctggattttggtccgacattgcttccgatttctactggaaa
gagaaatggagccagccagtctgctctgagaatcttgacgtcaggaatggaaatatcaag
attgagtggttcaagggaggaagaaccaacatttgctacaactgcttggatcgaaacatt
gaaagtggaaatggtggcaaagttgcaatctactgggaaggaaatgagcctggttttgat
gcttctttaacgtatgcccagctactggacaaagtgtgtcagcttgcaaattacttgaaa
gatatgggtgttagaaagggtgatgctgtagtgatctatttacccatgttaatggaactc
ccaatcgcaatgcttgcatgtgctcgcattggtgctgtacactcggtagtatttgcagga
ttttcctcagagtctcttgctcagagaatcgtagattgcaaaccaaaagtcgtgataact
tcaaatgctgttaaaagaggtcctaaggttatttccctcaaagacatagttgacgctgcc
cttgttgagtcagccaaaaatgggatctctgtagatgcatgcttaacctatgaaaatcaa
tctgcgatgaagagggaaactactaaatggcaggaaggaagagacatttggtggcaggat
gttgttcctaaatatccaactacttgtgatgtggagtgggttgatgcagaagatccactt
tttctgctctatacaagtgggagcacgggaaagcccaagggtgttctgcacacaactgga
ggatatatgatatatactgcgacaacattcaaatatgcatttgactacaagccgtctgat
gtatactggtgtacagctgactgtggttggattacaggacacagctatgttacttttgga
cctatgcttaatggggcgactgttattgtttttgaaggggctccaaattatccagattct
ggacgttgttgggacattgtagacaaatacaaggtgacgatattctatactgcccccact
ttggtgcgctccctcatgcgtgatggtgatgagtatgtcactcgttattcacgcaaatct
ttacgggttcttggaagtgtaggcgagccgatcaatccaagcgcatggaggtggtttttc
aatgttgttggagactcaaggtgtcctatatctgacacttggtggcaaacagagacgggt
ggcttcatgattactcctttaccaggtgcctggccccagaaaccaggttctgctactttt
cctttctttggtgttcagcctgttatagtggatgagaagggcattgagattgaaggtgag
tgtaatgggtatctgtgtgtgaaaagctcatggcctggggcattcagaactctttatggt
gatcatgatagatatgaaacaacctacttcaaggcatttcctggctattactttagtggt
gatggctgcagcagggacaaggatggatattactggctgactggaagagtagatgatgtc
atcaatgtcagtggacatcgaattggcacagcagaggtggaatctgcacttgtctcgcat
ccgaaatgtgctgaagctgctgtagttggtgttgagcatgaggtaaaagggcagggcata
tatgcatttgttactctagtagagggtgttccttacagtgaagaacttcggaaaagcctt
atcatgactgtgcgaagccagataggagcatttgctgcacctgacagaatccattgggcc
cctggccttccaaaaacaaggagtggaaagataatgaggaggattctgaggaagattgct
tccaggcagttaaatgaacttggtgacacaagtacactagcagatccgaatgtggttgat
gagcttattaaacttgctgattcataa

DBGET integrated database retrieval system