KEGG   Vitis vinifera (wine grape): 100263593Help
Entry
100263593         CDS       T01084                                 

Definition
uncharacterized LOC100263593
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100263593
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100263593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 445 aa AA seqDB search
MGVLDEGHVEVGFEQETLTIEEAVKVLLQGLGEDINREGLSKTPARVAKALREGTRGYRQ
KAKDIVQGALFPEAGLNNGIGHAGGVGGLVIVRDLDLFSYCESCLLPFQVKCHVGYVPSG
QCVVGLSKLSRVADVFAKRLQDPQRLADDVCSALNHGIKPAGVAVVLQCLHIHFPNLELG
FLDSTHQEWVTVSVCSGKGLFENAKATIWSDFLSLLKFRGINVEKTCTRDSTGPCWCPSQ
SSSALIPCKIETVHQMVTAVTSILRSLGEDPLRKGLVGTPNRYVTWLLNFEKTNKELKLD
GYVCGKMDPFQPNCNEEEMHSELNLAFWSQCEHHLLPFHGVVHIGYFCTKGTNPIAKSIL
QSIVHFYGFKLQVQERITRQVAETVSSLLGGDVIVVVEASHSCMVSRGIEKLGSNTATMA
LLGRFSTDDTAKTMFLQRIQNTPTS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcttggacgaggggcacgtggaggtgggatttgagcaagagactctaaccatt
gaggaggctgttaaagtgcttttgcagggtttgggtgaggatatcaatagggaaggcctg
agcaagactcctgcccgtgttgccaaggcccttcgtgaaggaactagaggttacagacaa
aaggcaaaggacattgttcaaggtgccttattccctgaagctggtttgaataatggaatt
ggtcatgcaggaggagtgggtgggcttgtgattgttcgggatcttgatctcttctcatac
tgcgaatcttgtttgcttccattccaggttaagtgtcatgtgggttatgtcccatcaggg
caatgcgttgtgggcttaagcaagctttctcgggtagctgatgtttttgcaaaacgactc
caagatccacagcgtcttgcagatgatgtgtgttctgctttgaaccatgggatcaagccc
gcaggtgttgctgttgtactccagtgtttacatattcatttcccaaatttagaattgggc
tttcttgattcaacccatcaagaatgggtaacagtatcagtttgttctggtaaaggcctt
tttgaaaatgcaaaggccaccatttggagtgattttttaagtctcctgaaattccgaggc
ataaatgtggagaaaacctgtaccagagattccacaggtccatgttggtgcccatcccag
tcttcctctgctttgattccatgcaagatagaaacagtccaccaaatggttactgcagta
acttcaattctgaggtctttgggtgaagacccattaaggaaagggctggtaggaacccct
aatcgttatgtgacgtggctgctgaactttgagaaaactaacaaggagctgaaattagat
ggctatgtttgtggtaaaatggatccttttcaacccaattgcaacgaggaagagatgcat
tctgagctgaacttggcattctggtctcaatgtgagcatcatttacttccctttcacggt
gttgtgcatataggctacttctgcaccaaagggaccaatcccattgcaaaatccatttta
cagtcaatagtacatttctatggcttcaagcttcaggtacaggaaagaattaccaggcaa
gttgctgagactgtttcatctctgttaggtggggatgtgatagtggtggtggaagctagt
cactcttgtatggtatccagaggaattgagaagttaggaagtaatactgctacaatggct
ctgcttggccgattttcaactgacgatactgcaaagaccatgtttttgcagagaattcaa
aacactccaacttcttga

DBGET integrated database retrieval system